
Biotin-β Amyloid (1-42) Human
Rif. 3D-CRB1000486
100µg
349,00€
500µg
477,00€

Informazioni sul prodotto
Nome:Biotin-β Amyloid (1-42) Human
Sinonimi:
- Biot-(Ahx)DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OHBiotin-Ahx-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-acidBiotin-Ahx-Asp-Al a-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Ly s-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Ser-Asn-Lys-Gly-Ala-Ile
Marchio:Biosynth
Descrizione:Amyloid β-protein (Aβ) has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer's disease (AD) and Down's syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD.Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then γ-secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS. Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival.This peptide contains a covalently attached N-Terminal biotin tag for convenient detection and purification.
Avviso:I nostri prodotti sono destinati esclusivamente ad uso di laboratorio. Per qualsiasi altro utilizzo, vi preghiamo di contattarci.
Proprietà chimiche
Purezza:Min. 95%
Colore/Forma:Powder
Richiesta tecnica su: Biotin-β Amyloid (1-42) Human
Si prega di utilizzare piuttosto il carrello per richiedere un preventivo o un ordine
Si prega di utilizzare piuttosto il carrello per richiedere un preventivo o un ordine. Se si desidera richiedere un preventivo o effettuare un ordine, si prega invece di aggiungere i prodotti desiderati al carrello e poi richiedere un preventivo o un ordine dal carrello. È più veloce, più economico, e potrà beneficiare degli sconti disponibili e di altri vantaggi.