Prodotto aggiunto correttamente al carrello.

discount label
GIP (1-42)-[C] human
Visualizzare in 3D

Biosynth logo

GIP (1-42)-[C] human

Rif. 3D-CRB1000509

1mg
474,00 €
100µg
284,00 €
500µg
389,00 €
Consegna stimata in Stati Uniti, il Martedì 04 Febbraio 2025

Informazioni sul prodotto

Nome:
GIP (1-42)-[C] human
Sinonimi:
  • H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQC-NH2
Descrizione:

Peptide derived from the Gastric inhibitory polypeptide (GIP), an inhibiting hormone of the secretin family of hormones. While GIP is a weak inhibitor of gastric acid secretion, its main role is to stimulate insulin secretion - in a glucose-dependent mechanism. Therefore, GIP is referred to as a glucose-dependent insulinotropic peptide.GIP is derived from a 153-amino acid pro-protein encoded by the GIP gene and circulates as a biologically active 42-amino acid peptide. It is synthesised by K cells, which are found in the mucosa of the duodenum and the jejunum of the gastrointestinal tract. GIP receptors are seven-transmembrane proteins found on β-cells in the pancreas. These β-cells are those that are able to simultaneously detect glucose and release insulin as a result to GIP binding.The clinical relevance of GIP is related to type 2 diabetes mellitus (T2DM)- studies have found that T2DM diabetics are unresponsive to GIP and have lower levels of GIP secretion after a meal when compared to non-diabetics. In research involving knockout mice, it was found that absence of the GIP receptors correlates with resistance to obesity.

Avviso:
I nostri prodotti sono destinati esclusivamente ad uso di laboratorio. Per qualsiasi altro utilizzo, vi preghiamo di contattarci.
Marchio:
Biosynth
Conservazione lunga:
Note:

Proprietà chimiche

Peso molecolare:
1,234.5 g/mol
MDL:
Punto di fusione:
Punto di ebollizione:
Punto di infiammabilità:
Densità:
Concentrazione:
EINECS:
Merck:
Codice SA:

Informazioni sui pericoli

Numero ONU:
EQ:
Classe:
Indicazioni di pericolo:
Consigli di prudenza:
Vietato trasportare in aereo:
Informazioni sui pericoli:
Gruppo di imballaggio:
LQ:

Richiesta tecnica su: 3D-CRB1000509 GIP (1-42)-[C] human

Si prega di utilizzare piuttosto il carrello per richiedere un preventivo o un ordine

Se si desidera richiedere un preventivo o effettuare un ordine, si prega invece di aggiungere i prodotti desiderati al carrello e poi richiedere un preventivo o un ordine dal carrello. È più veloce, più economico, e potrà beneficiare degli sconti disponibili e di altri vantaggi.

* Campi obbligatori
Benvenuto su CymitQuimica!Utilizziamo i cookie per migliorare la tua visita. Non includiamo pubblicità.

Consulta la nostra Politica sui Cookie per maggiori dettagli o regola le tue preferenze in "Configura".