
[Cys]-Exendin 4
Rif. 3D-CRB1000606
1mg
470,00€
500µg
386,00€

Informazioni sul prodotto
Nome:[Cys]-Exendin 4
Sinonimi:
- H-CHGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Marchio:Biosynth
Descrizione:Originally identified in Gila monster lizard (Heloderma suspectum), Exendin-4 is an incretin mimetic, an analog of glucagon-like-peptide-1 (GLP-1), it stimulates insulin secretion and modulates gastric emptying to slow the entry of ingested sugars into the bloodstream. Exendin-4 is resistant to cleavage by plasma DPP-IV unlike GLP-1. This gives it a longer half-life and duration of action than GLP-1, as well as greater potency in vivo. Exendin-4 increases insulin sensitivity and improves glucose tolerance and is currently used for the treatment of Type 2 diabetes mellitus in its synthetic form Exenatide.Exendin-4 also promotes the production and proliferation of β-cells leading to regeneration of the pancreas. It is a ligand to the exendin receptor and increases pancreatic acinar cell cAMP levels. However, the GLP-1 analog was found to have a toxic effect by inducing hypotension due to relaxation of the cardiac smooth muscle.This exendin-4 peptide is provided with an N-terminal cysteine residue for conjugation reactions.
Avviso:I nostri prodotti sono destinati esclusivamente ad uso di laboratorio. Per qualsiasi altro utilizzo, vi preghiamo di contattarci.
Proprietà chimiche
Peso molecolare:4,287 g/mol
Richiesta tecnica su: [Cys]-Exendin 4
Si prega di utilizzare piuttosto il carrello per richiedere un preventivo o un ordine
Si prega di utilizzare piuttosto il carrello per richiedere un preventivo o un ordine. Se si desidera richiedere un preventivo o effettuare un ordine, si prega invece di aggiungere i prodotti desiderati al carrello e poi richiedere un preventivo o un ordine dal carrello. È più veloce, più economico, e potrà beneficiare degli sconti disponibili e di altri vantaggi.