CymitQuimica logo

LL-37 amide

CAS:

Rif. 3D-CRB1000864

500µg
386,00€
1mg
470,00€
LL-37 amide
Biosynth

Informazioni sul prodotto

Nome:LL-37 amide
Sinonimi:
  • H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH2LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-amideH-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Gl u-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gl n-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-NH2
Marchio:Biosynth
Descrizione:LL-37 is a member of the large cationic family of anti-microbial peptides called cathelicidins which have broad-spectrum anti-microbial activity and are expressed in many species. The only cathelicidin found in humans is LL-37, this is produced in epithelial cells, by proteolytic cleavage from the C-terminal of the hCAP-18 protein. LL-37 can be processed into different forms of anti-microbial peptides. As well as its anti-microbial properties LL-37 also regulates many aspects of the innate immune system and overexpression of LL-37 has been linked to autoimmune diseases such as asthma and psoriasis, making LL-37 the most studied form of the human cathelicidin peptides.More recently, studies have shown that LL-37 binds to SARS-CoV-2 S protein and inhibits binding to its receptor hACE2, which may inhibit viral entry into the cell. LL-37 is upregulated by vitamin D, therefore this may be one mode of action for the positive outcomes seen with vitamin D treatment for Covid-19.
Avviso:I nostri prodotti sono destinati esclusivamente ad uso di laboratorio. Per qualsiasi altro utilizzo, vi preghiamo di contattarci.

Proprietà chimiche

Peso molecolare:4,493.3 g/mol
Formula:C205H341N61O52

Richiesta tecnica su: LL-37 amide

Si prega di utilizzare piuttosto il carrello per richiedere un preventivo o un ordine

Si prega di utilizzare piuttosto il carrello per richiedere un preventivo o un ordine. Se si desidera richiedere un preventivo o effettuare un ordine, si prega invece di aggiungere i prodotti desiderati al carrello e poi richiedere un preventivo o un ordine dal carrello. È più veloce, più economico, e potrà beneficiare degli sconti disponibili e di altri vantaggi.
◻️
CYMIT QUÍMICA, S.L., in qualità di responsabile del trattamento, tratterà i suoi dati per rispondere alle sue domande o richieste. Potete accedere, rettificare e cancellare i vostri dati, così come esercitare altri diritti consultando le informazioni supplementari e dettagliate sulla protezione dei dati nella nostra Informativa sulla privacy.
* Campi obbligatori.