GLP-1 (1-37)
Rif. 3D-CRB1001037
1mg | 478,00 € | ||
500µg | 286,00 € |
Informazioni sul prodotto
- H-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OHHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-acidH-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr- Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly -Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OHgp VIP
Glucagon-like peptide (GLP) 1 is a post-translationally modified version of proglucagon. GLP-1 (1-37) is a naturally produced analog of GLP-1. Unlike truncated GLP-1, GLP-1 (1-37) does not alter food intake in rat models or pancreatic insulin secretion. GLP-1 (1-37) can induce insulin production in developing adult intestinal cells via upregulation of the ngn3 gene and its downstream targets. This can restore glucose homeostasis when implanted into diabetic mice. GLP-1 (1-37) may offer a future treatment for diabetes mellitus. GLP-1 (1-37) can also inhibit chemokine-induced migration of human CD4-positive lymphocytes, an early step in atherogenesis. This raises the possibility that GLP-1 (1-37) is part of a novel mechanism to modulate vascular disease.
Proprietà chimiche
Richiesta tecnica su: 3D-CRB1001037 GLP-1 (1-37)
Se si desidera richiedere un preventivo o effettuare un ordine, si prega invece di aggiungere i prodotti desiderati al carrello e poi richiedere un preventivo o un ordine dal carrello. È più veloce, più economico, e potrà beneficiare degli sconti disponibili e di altri vantaggi.