CymitQuimica logo

Biotin BRC4 (1517-1551)

Rif. 3D-CRB1001302

1mg
470,00€
500µg
386,00€
Biotin BRC4 (1517-1551)
Biosynth

Informazioni sul prodotto

Nome:Biotin BRC4 (1517-1551)
Sinonimi:
  • Biot-(Ahx)KEPTLLGFHTASGKKVKIAKESLDKVKNLFDEKEQ-NH2Biotin-Ahx-KEPTLLGFHTASGKKVKIAKESLDKVKNLFDEKEQ-amideBiotin-Ahx-Lys-Glu-Pro-Thr-Le u-Leu-Gly-Phe-His-Thr-Ala-Ser-Gly-Lys-Lys-Val-Lys- Ile-Ala-Lys-Glu-Ser-Leu-Asp-Lys-Val-Lys-Asn-Leu-Phe-Asp-Glu-Lys-Glu-Gln
Marchio:Biosynth
Descrizione:Human BRCA2 is a key contributor to DNA damage repair and thus genomic integrity. Along with RAD51, BRCA2 ensures accurate and timely progression of homologous recombination (HR) at sites of double strand breaks to facilitate repair. BRCA2 also has an important additional function at the replication fork. BRCA2 therefore has anti-tumour properties and mutations in human BRCA2 protein cause a predisposition to breast and ovarian cancers and increase susceptibility to other tumorigenic conditions.BRCA2 interacts with RAD51 through a series of eight motifs called BRC repeats and a separate binding site located in the C-terminal region. Among eight BRC repeats involved in RAD51 binding, BRC4 displays the highest affinity for RAD51. The BRC4-RAD51 interaction may inhibit RAD51 oligomerization. Low concentrations of BRC4 enhance RAD51 binding to single stranded DNA and stimulate RAD51-mediated strand exchange, high concentrations of BRC4 disrupt RAD51 filament formation. Contains an N-terminal biotin tag for easy detection and purification.
Avviso:I nostri prodotti sono destinati esclusivamente ad uso di laboratorio. Per qualsiasi altro utilizzo, vi preghiamo di contattarci.

Proprietà chimiche

Peso molecolare:4,293.4 g/mol

Richiesta tecnica su: Biotin BRC4 (1517-1551)

Si prega di utilizzare piuttosto il carrello per richiedere un preventivo o un ordine

Si prega di utilizzare piuttosto il carrello per richiedere un preventivo o un ordine. Se si desidera richiedere un preventivo o effettuare un ordine, si prega invece di aggiungere i prodotti desiderati al carrello e poi richiedere un preventivo o un ordine dal carrello. È più veloce, più economico, e potrà beneficiare degli sconti disponibili e di altri vantaggi.
◻️
CYMIT QUÍMICA, S.L., in qualità di responsabile del trattamento, tratterà i suoi dati per rispondere alle sue domande o richieste. Potete accedere, rettificare e cancellare i vostri dati, così come esercitare altri diritti consultando le informazioni supplementari e dettagliate sulla protezione dei dati nella nostra Informativa sulla privacy.
* Campi obbligatori.