Informazioni sul prodotto
Nome:TAT-GSK'364A
Sinonimi:
- H-RKKRRQRRRAQAKVFGAGYPSLPTMTVSDWYEQHRKYG-OHRKKRRQRRRAQAKVFGAGYPSLP™TVSDWYEQHRKYG-acidH-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Ala-Gln -Ala-Lys-Val-Phe-Gly-Ala-Gly-Tyr-Pro-Ser-Leu -Pro-Thr-Met-Thr-Val-Ser-Asp-Trp-Tyr-Glu-Gln-His-Arg-Lys-Tyr-Gly-OH
Marchio:Biosynth
Descrizione:TAT-GSK'364A peptide is able to specifically mimic the binding sequence between Midline-1 (MID1) and the protein phosphatase 2A (PP2A) alpha4 complex and therefore can specifically outcompete MID1 from binding to alpha4-PP2Ac. TAT-GSK'364A therefore is useful in studying Alzheimer's disease (AD). AD is characterized by senile plaques, composed of amyloid-β (Aβ) peptides, derived from sequential proteolytic cleavage of the amyloid precursor protein (APP), and neurofibrillary tangles, composed of hyperphosphorylated tau protein.MID1 protein induces the translation of amyloid precursor protein (APP) mRNA via mTOR-eIF signalling and binds to PP2A to form the MID1-PP2A complex. PP2A is the main tau phosphatase and MID1 is a negative regulator of PP2A activity as it acts as an E3 ubiquitin ligase to promote the ubiquitin-dependent degradation of PP2A.GSK'364A contains 29-residue sequence from the alpha4 subunit (AQAKVFGAGYPSLPTMTVSDWYEQHRKYG) with an N-terminal sequence derived from HIV-TAT protein (RKKRRQRRR).
Avviso:I nostri prodotti sono destinati esclusivamente ad uso di laboratorio. Per qualsiasi altro utilizzo, vi preghiamo di contattarci.
Proprietà chimiche
Peso molecolare:4,607.4 g/mol