Amyloid beta/A4 Protein Precursor770 (740-770) trifluoroacetate salt
CAS: 1802086-24-3
Rif. 3D-FA109756
1mg | 272,00 € | ||
2mg | 457,00 € | ||
5mg | 740,00 € | ||
10mg | 1.286,00 € | ||
500µg | 175,00 € |
Informazioni sul prodotto
- H-Ala-Ala-Val-Thr-Pro-Glu-Glu-Arg-His-Leu-Ser-Lys-Met-Gln-Gln-Asn-Gly-Tyr-Glu-Asn-Pro-Thr-Tyr-Lys-Phe-Phe-Glu-Gln-Met-Gln-Asn-OH H- AAVTPEERHLSKMQQNGYENPTYKFFEQMQN-OH
Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (740-770) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Proprietà chimiche
Richiesta tecnica su: 3D-FA109756 Amyloid beta/A4 Protein Precursor770 (740-770) trifluoroacetate salt
Se si desidera richiedere un preventivo o effettuare un ordine, si prega invece di aggiungere i prodotti desiderati al carrello e poi richiedere un preventivo o un ordine dal carrello. È più veloce, più economico, e potrà beneficiare degli sconti disponibili e di altri vantaggi.