Big Endothelin-3 (1-41) amide (human) trifluoroacetate salt
CAS: 133551-97-0
Rif. 3D-FB110162
10mg | 1.739,00 € | ||
25mg | 2.319,00 € | ||
50mg | 2.898,00 € | ||
100mg | 4.057,00 € | ||
250mg | 5.797,00 € |
Informazioni sul prodotto
- H-CTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFR-NH2
Big endothelin-3 is a peptide that is a potent inhibitor of the endothelin receptor. It has been shown to inhibit the binding of endothelin to its receptors and antagonize the effects of endothelin on cells. Big endothelin-3 is a research tool for studying protein interactions, activators, and ligands. This product is the ammonium acetate salt form.
Proprietà chimiche
Richiesta tecnica su: 3D-FB110162 Big Endothelin-3 (1-41) amide (human) trifluoroacetate salt
Se si desidera richiedere un preventivo o effettuare un ordine, si prega invece di aggiungere i prodotti desiderati al carrello e poi richiedere un preventivo o un ordine dal carrello. È più veloce, più economico, e potrà beneficiare degli sconti disponibili e di altri vantaggi.