Cys-Gly-Lys-Arg-Amyloid b-Protein (1-42)
CAS: 1802086-21-0
Rif. 3D-FC109823
1mg | 454,00 € | ||
2mg | 752,00 € | ||
5mg | 1.500,00 € | ||
250µg | 179,00 € | ||
500µg | 315,00 € |
Informazioni sul prodotto
- H-Cys-Gly-Lys-Arg-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gl y-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH H-CGKRDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH
Please enquire for more information about Cys-Gly-Lys-Arg-Amyloid b-Protein (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Proprietà chimiche
Richiesta tecnica su: 3D-FC109823 Cys-Gly-Lys-Arg-Amyloid b-Protein (1-42)
Se si desidera richiedere un preventivo o effettuare un ordine, si prega invece di aggiungere i prodotti desiderati al carrello e poi richiedere un preventivo o un ordine dal carrello. È più veloce, più economico, e potrà beneficiare degli sconti disponibili e di altri vantaggi.