(Gly28,Cys30)-Amyloid b-Protein (1-30) amide trifluoroacetate salt
CAS: 1802080-88-1
Rif. 3D-FG109822
1mg | 376,00 € | ||
2mg | 574,00 € | ||
5mg | 1.018,00 € | ||
10mg | 1.714,00 € | ||
500µg | 236,00 € |
Informazioni sul prodotto
- H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys -Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Gly-Gly-Cys-NH2 H-DA EFRHDSGYEVHHQKLVFFAEDVGSNGGC-NH2
Please enquire for more information about (Gly28,Cys30)-Amyloid b-Protein (1-30) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Proprietà chimiche
Richiesta tecnica su: 3D-FG109822 (Gly28,Cys30)-Amyloid b-Protein (1-30) amide trifluoroacetate salt
Se si desidera richiedere un preventivo o effettuare un ordine, si prega invece di aggiungere i prodotti desiderati al carrello e poi richiedere un preventivo o un ordine dal carrello. È più veloce, più economico, e potrà beneficiare degli sconti disponibili e di altri vantaggi.