(Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS: 175010-18-1
Rif. 3D-FG109934
1mg | 490,00 € | ||
2mg | 797,00 € | ||
5mg | 1.446,00 € | ||
10mg | 2.464,00 € | ||
500µg | 336,00 € |
Informazioni sul prodotto
- H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe -Phe-Ala-Gly-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-G ly-Leu-Met-Val-Gly-Gly-Val-Val-OH H-DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV-OH
Please enquire for more information about (Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Proprietà chimiche
Richiesta tecnica su: 3D-FG109934 (Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt
Se si desidera richiedere un preventivo o effettuare un ordine, si prega invece di aggiungere i prodotti desiderati al carrello e poi richiedere un preventivo o un ordine dal carrello. È più veloce, più economico, e potrà beneficiare degli sconti disponibili e di altri vantaggi.