(Gln22,Asn23)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS: 374796-75-5
Rif. 3D-FG110092
1mg | 865,00 € | ||
2mg | 1.414,00 € | ||
100µg | 182,00 € | ||
250µg | 343,00 € | ||
500µg | 526,00 € |
Informazioni sul prodotto
- H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asn-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gl y-Leu-Met-Val-Gly-Gly-Val-Val-OH H-DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV-OH
Please enquire for more information about (Gln22,Asn23)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Proprietà chimiche
Richiesta tecnica su: 3D-FG110092 (Gln22,Asn23)-Amyloid b-Protein (1-40) trifluoroacetate salt
Se si desidera richiedere un preventivo o effettuare un ordine, si prega invece di aggiungere i prodotti desiderati al carrello e poi richiedere un preventivo o un ordine dal carrello. È più veloce, più economico, e potrà beneficiare degli sconti disponibili e di altri vantaggi.