PACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS: 124123-15-5
Rif. 3D-FP110313
1mg | 1.211,00 € | ||
2mg | 2.121,00 € | ||
100µg | 338,00 € | ||
250µg | 448,00 € | ||
500µg | 740,00 € |
Informazioni sul prodotto
- H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln -Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-G ln-Arg-Val-Lys-Asn-Lys-NH2 H-HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
- H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2
PACAP-38 is a peptide that has been shown to have a variety of physiological effects, including the regulation of brain functions and immunological responses. PACAP-38 has been found to bind to toll-like receptor 4 (TLR4) in macrophages and neutrophils, which stimulates the production of proinflammatory cytokines. It also interacts with adenylate cyclase, which leads to an increase in cAMP levels. This may be the mechanism by which PACAP-38 regulates brain functions. The biological function of PACAP-38 is not yet clear but it may act as a signal peptide, regulating protein synthesis and gene expression.
Proprietà chimiche
Richiesta tecnica su: 3D-FP110313 PACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
Se si desidera richiedere un preventivo o effettuare un ordine, si prega invece di aggiungere i prodotti desiderati al carrello e poi richiedere un preventivo o un ordine dal carrello. È più veloce, più economico, e potrà beneficiare degli sconti disponibili e di altri vantaggi.