H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH
Rif. 3D-PP42449
| Dimensione non definita | Prezzo su richiesta |
Informazioni sul prodotto
Peptide H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH include the following: Correction: Al-Zamel, N., et al. A Dual GLP-1/GIP Receptor agonist Does Not Antagonize Glucagon at Its Receptor but May Act as a Biased agonist at the GLP-1 N Al-Zamel, S Al-Sabah , Y Luqmani, L Adi - International journal of , 2020 - mdpi.comhttps://www.mdpi.com/1422-0067/21/9/3357 Study on gastric inhibitory polypeptide: Synthesis and properties C Dafu, C Hengran, X Minghua, C Huiting - Acta Biochimica et , 1994 - europepmc.orghttps://europepmc.org/article/cba/272803
Proprietà chimiche
Richiesta tecnica su: 3D-PP42449 H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH
Se si desidera richiedere un preventivo o effettuare un ordine, si prega invece di aggiungere i prodotti desiderati al carrello e poi richiedere un preventivo o un ordine dal carrello. È più veloce, più economico, e potrà beneficiare degli sconti disponibili e di altri vantaggi.
