H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-OH

Rif. 3D-PP42450

Informazioni sul prodotto

• Nome: H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-OH

Descrizione

Peptide H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-OH include the following: Correction: Al-Zamel, N., et al. A Dual GLP-1/GIP Receptor agonist Does Not Antagonize Glucagon at Its Receptor but May Act as a Biased agonist at the GLP-1 N Al-Zamel, S Al-Sabah , Y Luqmani, L Adi - International journal of , 2020 - mdpi.comhttps://www.mdpi.com/1422-0067/21/9/3357 Study on gastric inhibitory polypeptide: Synthesis and properties C Dafu, C Hengran, X Minghua, C Huiting - Acta Biochimica et , 1994 - europepmc.orghttps://europepmc.org/article/cba/272803

• Marchio: Biosynth