H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH
Rif. 3D-PP47267
| Dimensione non definita | Prezzo su richiesta |
Informazioni sul prodotto
Peptide H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH include the following: EGFR S1166 phosphorylation induced by a combination of EGF and gefitinib has a potentially negative impact on lung cancer cell growth BF Assiddiq, KY Tan, W Toy, SP Chan - Journal of proteome , 2012 - ACS Publicationshttps://pubs.acs.org/doi/abs/10.1021/pr3002029
Proprietà chimiche
Richiesta tecnica su: 3D-PP47267 H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH
Se si desidera richiedere un preventivo o effettuare un ordine, si prega invece di aggiungere i prodotti desiderati al carrello e poi richiedere un preventivo o un ordine dal carrello. È più veloce, più economico, e potrà beneficiare degli sconti disponibili e di altri vantaggi.
