H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH
Rif. 3D-PP47702
| Dimensione non definita | Prezzo su richiesta |
Informazioni sul prodotto
Peptide H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH include the following: Review of a current role of mass spectrometry for proteome research CHW Chen - Analytica chimica acta, 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S000326700801132X Mass spectrometry for high-throughput proteome analysis and biomarker discovery CH Chen - Hiroshima Conference on Education and Science in - hiroshima-u.ac.jphttps://www.hiroshima-u.ac.jp/system/files/58163/5thHC_Proceedings.pdf#page=69
Proprietà chimiche
Richiesta tecnica su: 3D-PP47702 H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH
Se si desidera richiedere un preventivo o effettuare un ordine, si prega invece di aggiungere i prodotti desiderati al carrello e poi richiedere un preventivo o un ordine dal carrello. È più veloce, più economico, e potrà beneficiare degli sconti disponibili e di altri vantaggi.
