H-PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC-OH
Rif. 3D-PP49553
| 1mg | 601,00 € | ||
| 10mg | 740,00 € | ||
| 100mg | 1.462,00 € |
Informazioni sul prodotto
Peptide H-PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC-OH include the following: TransCon CNP, a sustained-release C-type natriuretic peptide prodrug, a potentially safe and efficacious new therapeutic modality for the treatment of comorbidities VM Breinholt, CE Rasmussen, PH Mygind - of Pharmacology and , 2019 - ASPEThttps://jpet.aspetjournals.org/content/370/3/459.abstract
Proprietà chimiche
Richiesta tecnica su: 3D-PP49553 H-PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC-OH
Se si desidera richiedere un preventivo o effettuare un ordine, si prega invece di aggiungere i prodotti desiderati al carrello e poi richiedere un preventivo o un ordine dal carrello. È più veloce, più economico, e potrà beneficiare degli sconti disponibili e di altri vantaggi.
