H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2
Rif. 3D-PP49768
| Dimensione non definita | Prezzo su richiesta |
Informazioni sul prodotto
Peptide H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2 include the following: Lipid nanoparticles produce chimeric antigen receptor T cells with interleukin-6 knockdown in vivo J Zhou, L Sun , Y Jia, Z Wang, T Luo, J Tan - Journal of Controlled , 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0168365922005387
Proprietà chimiche
Richiesta tecnica su: 3D-PP49768 H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2
Se si desidera richiedere un preventivo o effettuare un ordine, si prega invece di aggiungere i prodotti desiderati al carrello e poi richiedere un preventivo o un ordine dal carrello. È più veloce, più economico, e potrà beneficiare degli sconti disponibili e di altri vantaggi.
