Informazioni sul prodotto
- H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPP
H2N-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-amide is a catalog research peptide that is held in stock. This peptide is provided at >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer the product in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H2N-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-amide at the technical inquiry form on this page"
Proprietà chimiche
Richiesta tecnica su: 3D-VAA-19699 Exendin 4
Se si desidera richiedere un preventivo o effettuare un ordine, si prega invece di aggiungere i prodotti desiderati al carrello e poi richiedere un preventivo o un ordine dal carrello. È più veloce, più economico, e potrà beneficiare degli sconti disponibili e di altri vantaggi.