CAS 12279-41-3

Seractide

Descrição:

Seractide, com o número CAS 12279-41-3, é um composto químico conhecido principalmente por sua aplicação no campo da farmacêutica e bioquímica. É um surfactante sintético que exibe propriedades como emulsificação, umectação e dispersão, tornando-o útil em várias formulações. Seractide é frequentemente utilizado na preparação de sistemas de liberação de medicamentos, melhorando a solubilidade e biodisponibilidade de compostos pouco solúveis. Sua natureza anfifílica permite que interaja com substâncias hidrofílicas e hidrofóbicas, facilitando a estabilização de emulsões e suspensões. Além disso, Seractide pode possuir atividade biológica, contribuindo para seu papel em aumentar a eficácia de agentes terapêuticos. Precauções de segurança e manuseio são essenciais ao trabalhar com este composto, assim como com muitos surfactantes, devido a potenciais propriedades irritantes. No geral, Seractide serve como uma ferramenta valiosa em formulações farmacêuticas e pesquisa, contribuindo para os avanços em tecnologias de liberação de medicamentos.

Fórmula: C₂₀₇H₃₀₈N₅₆O₅₈S₁

Sinónimos:

• L-Seryl-L-tyrosyl-L-seryl-L-methionyl-L-alpha-glutamyl-L-histidyl-L-phenylalanyl-L-arginyl-L-tryptophylglycyl-L-lysyl-L-prolyl-L-valylglycyl-L-lysyl-L-lysyl-L-arginyl-L-arginyl-L-prolyl-L-valyl-L-lysyl-L-valyl-L-tyrosyl-L-prolyl-L-asparaginylglycyl-L-alanyl-L-alpha-glutamyl-L-alpha-aspartyl-L-alpha-glutamyl-L-seryl-L-alanyl-L-alpha-glutamyl-L-alanyl-L-phenylalanyl-L-prolyl-L-leucyl-L-alpha-glutamyl-L-phenylalanine
• Acth(1-39)
• CORTICOTROPIN (HUMAN)
• ACTH (1-39), HUMAN
• Seractide USP/EP/BP
• H-SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE-OH
• ADRENOCORTICOTROPIC HORMONE (1-39) (HUMAN)
• Seractide
• CORTICOTROPIN A
• REF DUPL: Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe
• ACTH (1-39) (huMan)
• Adrenocorticotropic hormone fragment 1-39, ≥97% (HPLC)
• SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE
• ACTH (1-39) (human) trifluoroacetate salt H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH trifluoroacetate salt
• Adrenocorticotropic Hormone (ACTH) (1-39)
• H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH
• Seractide ACTH
• Adrenocorticotropic Hormone (ACTH) (1-39), human
• Seractide acetate
• PCorticotropin (Human) CAS 12279-41-3
• ACTH
• M.W. 4541.07 C207H308N56O58S
• CORTICOTROPHIN
• Corticotropin
• adrenocorticotropic hormone fragment 1-39
• SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
• SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE HUMAN
• ADRENOCORTICOTROPIC HORMONE HUMAN

ACTH (1-39) (human)

CAS: 12279-41-3

The major regulator of adrenal cortex function. ACTH stimulates the synthesis of steroidal hormones.

Fórmula: C₂₀₇H₃₀₈N₅₆O₅₈S

Pureza: 99.2%

Cor e Forma: White

Peso molecular: 4541.13

Ref: 01-4030325

a1-39-Corticotropin (human)

CAS: 12279-41-3

Fórmula: C₂₀₇H₃₀₈N₅₆O₅₈S

Pureza: 98%

Cor e Forma: Solid

Peso molecular: 4541.0658

Ref: IN-DA01CP9W

ACTH (1-39) human

CAS: 12279-41-3

Adrenocorticotropic Hormone (ACTH) (1-39), human (ACTH (1-39), human) is an agonist of melanocortin receptor.

Fórmula: C₂₀₇H₃₀₈N₅₆O₅₈S

Pureza: 99.6%

Cor e Forma: White Lyophilised Solid

Peso molecular: 4541.14

Ref: TM-T8231

ACTH(1-39) trifluoroacetate

CAS: 12279-41-3

ACTH(1-39) trifluoroacetate is a synthetic form of ACTH that is used for the diagnosis of autoimmune diseases and bowel disease. It is also used to assess the function of the adrenal gland in cases of suspected Cushing's syndrome. The blood sampling procedure involves withdrawing a small amount of blood from the patient and adding ACTH(1-39) trifluoroacetate to it, which causes an increase in cortisol concentration. ACTH(1-39) trifluoroacetate binds to corticotropin receptors on cells in the body, causing them to release basic proteins that are responsible for inflammation. This drug may be a potential biomarker for metabolic disorders such as obesity. It has been shown to have anti-inflammatory properties and can be used as a nonsteroidal anti-inflammatory drug (NSAID).

Fórmula: C₂₀₇H₃₀₈N₅₆O₅₈S

Pureza: Min. 98 Area-%

Cor e Forma: Powder

Peso molecular: 4,541.07 g/mol

Ref: 3D-FA108368