CAS 130357-25-4

Exendina-3

Descrição:

Exendina-3 é um peptídeo derivado da saliva do monstro de Gila (Heloderma suspectum) e é conhecido por seu papel como agonista do receptor do peptídeo 1 semelhante ao glucagon (GLP-1). Consiste em 39 aminoácidos e exibe semelhanças estruturais com o GLP-1 humano, que está envolvido no metabolismo da glicose e na secreção de insulina. Exendina-3 ganhou atenção por suas potenciais aplicações terapêuticas no tratamento do diabetes tipo 2 e da obesidade devido à sua capacidade de aumentar a secreção de insulina em resposta à glicose, inibir a liberação de glucagon e promover a saciedade. A substância é caracterizada por sua estabilidade e ação prolongada em comparação com o GLP-1 nativo, tornando-se um candidato valioso para o desenvolvimento farmacológico. Além disso, Exendina-3 tem sido estudado por seus efeitos neuroprotetores e potenciais aplicações em doenças neurodegenerativas. Seu número CAS, 130357-25-4, é um identificador único que facilita a identificação e o estudo deste composto químico específico na literatura científica e em contextos regulatórios.

Fórmula: C₁₈₄H₂₈₂N₅₀O₆₁S

Sinónimos:

• H-HIS-SER-ASP-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
• Exendin-3 >=97%
• HIS-SER-ASP-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2: HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
• EXENDIN-3
• M.W. 4202.57 C184H282N50O61S
• HIS-SER-ASP-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
• EXENDIN-3 USP/EP/BP
• HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Exendin-3

CAS: 130357-25-4

Exendin-3, a member of the glucagon superfamily, was originally isolated from the venom of the lizard, Heloderma horridum. At low concentrations, the 39-amino acid peptide interacts with putative exendin receptors causing an increase in pancreatic acinar cAMP, whereas at higher concentrations it interacts with VIP receptors to stimulate an increase in cellular cAMP and amylase release.

Fórmula: C₁₈₄H₂₈₂N₅₀O₆₁S

Pureza: 98.6%

Peso molecular: 4202.63

Ref: 01-4015051

Exendin-3

CAS: 130357-25-4

Exendin-3, a peptide from Gila monster venom, stimulates pancreatic secretion and belongs to the glucagon family.

Fórmula: C₁₈₄H₂₈₂N₅₀O₆₁S

Pureza: 98%

Cor e Forma: Solid

Peso molecular: 4202.57

Ref: TM-TP1768

Exendin-3

CAS: 130357-25-4

Fórmula: C₁₈₄H₂₈₂N₅₀O₆₁S

Peso molecular: 4202.56

Ref: 7W-GK4553

Exendin-3

CAS: 130357-25-4

Please enquire for more information about Exendin-3 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Fórmula: C₁₈₄H₂₈₂N₅₀O₆₁S

Pureza: Min. 95%

Peso molecular: 4,202.57 g/mol

Ref: 3D-FE110340