CAS 133514-43-9

fragmento de exendina 9-39

Descrição:

fragmento de exendina 9-39 é um peptídeo derivado da molécula exendina-4, que é um análogo do peptídeo-1 semelhante ao glucagon (GLP-1). Este fragmento específico é conhecido por seu papel como antagonista competitivo do receptor GLP-1, que é significativo na regulação do metabolismo da glicose e na secreção de insulina. O peptídeo consiste em 31 aminoácidos e é caracterizado por sua capacidade de inibir as ações do GLP-1, tornando-se um assunto de interesse na pesquisa sobre diabetes e potenciais aplicações terapêuticas. Sua estrutura inclui uma sequência que permite que ele se ligue ao receptor GLP-1, mas ao contrário do GLP-1, não ativa o receptor, bloqueando assim seus efeitos. O número CAS 133514-43-9 identifica exclusivamente este composto em bancos de dados químicos, facilitando seu estudo e aplicação em contextos farmacológicos. No geral, fragmento de exendina 9-39 serve como uma ferramenta valiosa para entender a sinalização do receptor GLP-1 e suas implicações em distúrbios metabólicos.

Fórmula: C₁₄₉H₂₃₄N₄₀O₄₇S

Sinónimos:

• Exendin (9-39)
• Exendin(9-39)amide
• Exendin 3 (heloderma horridum), 1-de-L-histidine-2-de-L-serine-3-de-L-aspartic acid-4-deglycine-5-de-L-threonine-6-de-L-phenylalanine-7-de-L-threonine-8-de-L-serine-
• H-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
• Exendin-3 (9-39) amide USP/EP/BP
• H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 acetate salt
• Exendin Fragment 9-39 >=95% (HPLC)
• 9-39-Exendin 3(Heloderma horridum) (9CI)
• EXENDIN-3 (9-39) AMIDE
• H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
• 9-39-Exendin 3(Heloderma horridum)
• DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
• L-Serinamide, L-α-aspartyl-L-leucyl-L-seryl-L-lysyl-L-glutaminyl-L-methionyl-L-α-glutamyl-L-α-glutamyl-L-α-glutamyl-L-alanyl-L-valyl-L-arginyl-L-leucyl-L-phenylalanyl-L-isoleucyl-L-α-glutamyl-L-tryptophyl-L-leucyl-L-lysyl-L-asparaginylglycylglycyl-L-prolyl-L-seryl-L-serylglycyl-L-alanyl-L-prolyl-L-p...
• Exendin 4 (9-39) amide
• ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2: DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
• M.W. 3369.79 C149H234N40O47S
• Exendin FragMent 9-39Exendin
• ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2
• EXENDIN [9-39] PEPTIDE
• EXENDIN FRAGMENT 9-39
• EXENDIN FRAGMENT 9-39;EXENDIN (9-39)
• Asp-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRp-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2, ≥95%(HPLC)
• Exendin (9-39) Acetate

Exendin (9-39)

CAS: 133514-43-9

For cellular and molecular biology applications

Fórmula: C₁₄₉H₂₃₄N₄₀O₄₇S

Peso molecular: 3369.75

Ref: 02-J66126

Exendin (9-39)

CAS: 133514-43-9

Exendin (9-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. It has also been described as an antagonist of the putative exendin receptor. Exendin (9-39) blocks the stimulatory action of GLP-1 (7- 36) amide and of exendin-4 on cAMP production in pancreatic acini. Moreover, exendin (9-39) was shown to be safely used to abolish the incretin effect of GLP-1 without interfering with the control of insulin secretion by circulating nutrients.

Fórmula: C₁₄₉H₂₃₄N₄₀O₄₇S

Pureza: 97.4%

Cor e Forma: White Powder

Peso molecular: 3369.8

Ref: 01-4017799

Exendin (9-39)

CAS: 133514-43-9

Fórmula: C₁₄₉H₂₃₄N₄₀O₄₇S

Pureza: 99%

Cor e Forma: Solid

Peso molecular: 3369.7571

Ref: IN-DA00ILPD

Exendin Fragment 9-39

CAS: 133514-43-9

Fórmula: C₁₄₉H₂₃₄N₄₀O₄₇S

Pureza: ≥ 95.0%

Cor e Forma: White powder

Peso molecular: 3369.75

Ref: 7W-GK0935

Avexitide

CAS: 133514-43-9

Avexitide (Exendin-3 (9-39) amide) (Exendin (9-39)) is a specific and competitive antagonist of glucagon-like peptide-1 (GLP-1) receptor.

Fórmula: C₁₄₉H₂₃₄N₄₀O₄₇S

Pureza: 98% - 99.65%

Cor e Forma: Solid

Peso molecular: 3369.76

Ref: TM-TP2100

Exendin (9-39)

CAS: 133514-43-9

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Fórmula: C₁₄₉H₂₃₄N₄₀O₄₇S

Peso molecular: 3,369.79 g/mol

Ref: 3D-PP50554

Exendin (9-39) acetate

CAS: 133514-43-9

Exendin (9-39) acetate is a peptide hormone that is derived from the salivary gland of the Gila monster. It binds to receptors in the pancreas and inhibits insulin release. Exendin (9-39) acetate has been shown to increase glomerular filtration rate, natriuresis, and plasma glucose levels in animals. This peptide also increases soluble guanylate cyclase activity, which leads to an increase in cellular cGMP levels and vasodilation. Exendin (9-39) acetate has been shown to inhibit the production of cyclic guanosine monophosphate (cGMP) by inhibiting adenylyl cyclase activity. It also binds to receptors on pancreatic beta cells and inhibits insulin release, as well as binding to receptors on vascular smooth muscle cells and causing vasodilation.

Fórmula: C₁₄₉H₂₃₄N₄₀O₄₇S

Pureza: Min. 95%

Peso molecular: 3,369.76 g/mol

Ref: 3D-FE110341