CAS 197922-42-2

Teduglutida

Descrição:

Teduglutida é um análogo sintético do peptídeo semelhante ao glucagon humano-2 (GLP-2), um hormônio envolvido na regulação do crescimento e da função intestinal. É utilizado principalmente no tratamento da síndrome do intestino curto, uma condição que pode surgir após a remoção cirúrgica de uma parte significativa do intestino. Teduglutida promove a absorção intestinal de nutrientes e fluidos, melhorando assim a qualidade de vida dos pacientes com essa condição. A substância é administrada por injeção subcutânea e tem uma meia-vida relativamente longa devido à sua resistência à degradação enzimática. Seu mecanismo de ação envolve a ligação ao receptor de GLP-2, levando a um crescimento melhorado da mucosa intestinal, aumento da altura das vilosidades e melhor absorção de nutrientes. Efeitos colaterais comuns podem incluir sintomas gastrointestinais, como náuseas e dor abdominal, bem como riscos potenciais de neoplasia devido aos seus efeitos promotores de crescimento. No geral, Teduglutida representa um avanço significativo no manejo da síndrome do intestino curto, oferecendo aos pacientes um melhor estado nutricional e menor dependência do suporte parenteral.

Fórmula: C₁₆₄H₂₅₂N₄₄O₅₅S

Sinónimos:

• Alx 0600

ALX 0600

CAS: 197922-42-2

Fórmula: C₁₆₄H₂₅₂N₄₄O₅₅S

Pureza: 98%

Cor e Forma: Solid

Peso molecular: 3752.0825

Ref: IN-DA00ACKN

Teduglutide

CAS: 197922-42-2

Fórmula: C₁₆₄H₂₅₂N₄₄O₅₅S

Peso molecular: 3752.13

Ref: 4Z-PT-312001

Teduglutide-d8 TFA salt x hydrate (Leu-methyl-d3+Phe-d5)

Produto Controlado

CAS: 197922-42-2

Applications Teduglutide-d8 TFA salt x hydrate (Leu-methyl-d3+Phe-d5) is an isotopically labelled form of Teduglutide (T013795), which is glucagon-like peptide-2 (GLP-2) analogue that is used for the treatment of short bowel syndrome.
References Jeppesen, P., et al.: Gut, 54, 1224 (2005)
Chemical Name: Jeppesen, P., et al.: Gut, 54, 1224 (2005)

Fórmula: C₁₆₄H₂₄₄D₈N₄₄O₅₅S•C₂HF₃O₂•x(H₂O)

Cor e Forma: Neat

Peso molecular: 3760.081140218

Ref: TR-T013798

Teduglutide

CAS: 197922-42-2

Teduglutide (ALX-0600) is a glucagon-like peptide-2 analog that increases intestinal absorption and can be used in research on short bowel syndrome (SBS).

Fórmula: C₁₆₄H₂₅₂N₄₄O₅₅S

Pureza: 98.08%

Cor e Forma: Solid

Peso molecular: 3752.08

Ref: TM-T35337

Teduglutide

CAS: 197922-42-2

Teduglutide is a Glucagon-like Peptide-2 Analog which has been used in the treatment of Short Bowel Syndrome. It is avaiable in the Trifluoroacetate salt form.
One-Letter Formula: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD

Fórmula: C₁₆₄H₂₅₂N₄₄O₅₅S

Pureza: Min. 95%

Peso molecular: 3,752.16 g/mol

Ref: 3D-TED-3880-PI

Teduglutide (GLP2 2G)

CAS: 197922-42-2

Teduglutide is a GLP-2 analogue, in which the alanine at position 2 has been substituted with glycine making the peptide resistant to degradation by dipeptidyl peptidase-4 (DPP-4)- Teduglutide therefore has a longer half-life than GLP-2 (2-3 hours for teduglutide vs 7 min for GLP-2). Teduglutide has high bioavailability after subcutaneous administration, suggesting that teduglutide has enhanced biological activity, relative to native GLP-2.GLP-2 is a gut hormone produced in the enteroendocrine L cells of gastrointestinal tract by the cleavage of the 160-amino-acid proglucagon molecule. GLP-2 is secreted following the ingestion of food and carries out its activities via the GLP-2 G-protein coupled receptors (GLP-2Rs). GLP-2 has a range of roles within the cell, including: anti-inflammatory effects- promoting the expansion of the intestinal mucosa- stimulating intestinal blood flow- inhibiting gastric acid secretion and gastric emptying- increasing intestinal barrier function and enhancing nutrient and fluid absorption.

Fórmula: C₁₆₄H₂₅₂N₄₄O₅₅S

Cor e Forma: Powder

Peso molecular: 3,749.8 g/mol

Ref: 3D-CRB1000390

Teduglutide trifluoroacetate

CAS: 197922-42-2

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Fórmula: C₁₆₄H₂₅₂N₄₄O₅₅S

Peso molecular: 3,752.08 g/mol

Ref: 3D-PP50564