
CAS 9015-71-8
:Fator liberador de corticotropina
Descrição:
Fator liberador de corticotropina (CRF), também conhecido como hormônio liberador de corticotropina (CRH), é um hormônio peptídico envolvido na resposta ao estresse. É produzido no hipotálamo e desempenha um papel crucial no eixo hipotálamo-hipófise-adrenal (HPA) ao estimular a liberação de hormônio adrenocorticotrópico (ACTH) da glândula pituitária. O CRF é composto por 41 aminoácidos e exibe uma variedade de atividades biológicas, incluindo a modulação da resposta imunológica e influência no comportamento e no humor. A substância é caracterizada por sua capacidade de se ligar a receptores específicos, a saber, os receptores de CRF 1 e 2, que estão distribuídos por todo o cérebro e tecidos periféricos. O CRF também está implicado em vários processos fisiológicos, incluindo a regulação dos ritmos circadianos e a resposta a estressores. Sua desregulação está associada a vários distúrbios psiquiátricos e fisiológicos, tornando-o um alvo para pesquisa em condições relacionadas ao estresse. O número CAS 9015-71-8 identifica exclusivamente este peptídeo em bancos de dados químicos, facilitando seu estudo e aplicação em pesquisa biomédica.
Fórmula:C205H339N59O63S1
Sinónimos:- ACTH - releasing factor
- ACTH-releasing hormone
- CRF
- CRF (hormone)
- CRH
- Corticoliberin
- Corticotrophin-releasing hormone
- Corticotropin-Releasing Hormone
- Corticotropin-releasing activity
- Corticotropin-releasing hormone-41
- Crf (Ovine)
- Crf-41
- Corticotropin-releasing factor
- Corticotropin-releasing factor
- CORTICOTROPIN RELEASING FACTOR SHEEP
- corticotropin-releasinghormone))-
- H-SER-GLN-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-THR-LYS-ALA-ASP-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-LEU-ASP-ILE-ALA-NH2
- SER-GLN-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-THR-LYS-ALA-ASP-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-LEU-ASP-ILE-ALA-NH2 OVINE
- Corticotropin releasing factor 41
- SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
- SER-GLN-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-THR-LYS-ALA-ASP-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-LEU-ASP-ILE-ALA-NH2
- Corticorelin Ovine (x = 4.1-8.2)
- Corticotropin Releasing Factor sheep, ≥95% (HPLC)
- CRF, CRH
- Corticotropin Releasing Factor, CRF, ovine
- CORTICOTROPIN RELEASING FACTOR, OVINE
- Ver mais sinónimos
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
2 produtos.
CRF (Ovine)
CAS:<p>Corticotropin Releasing Factor (CRF) is a peptide hormone involved in the regulation of the neuroendocrine system, the hypothalamic-pituitary-adrenal (HPA) axis. The hypothalamus releases CRF during stress and in turn CRF stimulates the production of stress hormones such as glucocorticoids and adrenocorticotropin (ACTH). A negative feedback loop is created as glucocorticoids then prevents further endocrine activity exhibited by the pituitary gland and hypothalamus. Interestingly in patients with depression, it has been found that the hypothalamic-pituitary adrenal axis is over stimulated thus increased production of CRF occurs resulting in depression symptoms. Furthermore studies have shown the expression of CRF receptors in glial cells and T-cells and elevated levels of CRF and glucocorticoids prevent T-cell proliferation. During stress cytokines can also stimulate the secretion of CRF. However CRF can also regulate these cytokines. CRF has the potential to be used in the research into depression treatments. <br>This product is available as a 0.1mg vial.</p>Fórmula:C205H339N59O63SPureza:Min. 95%Peso molecular:4,670.3 g/molCRF (Ovine)
CAS:<p>This product is an ovine, Corticotropin Release Factor (CRF) and is available as a 0.5mg vial. CRF is a peptide hormone and a key regulator of the hypothalamic-pituitary adrenal (HPA) axis. In response to stress the hypothalams releases CRF which stimulates the production of glucocorticoids and adrenocorticotropin, which are stress hormones. Glucocorticoids are then involved in a negative feedback loop, in that they prevent the pituitary gland and hypothalamus from exhibiting any further endocrine activity. Studies have shown that symptoms of depression can be caused by the over production of CRF due to the overstimulation of the hypothalamic-pituitary adrenal axis. Interestingly CRF receptors are expressed in both glial cells and T cells. Elevated levels of CRF and glucocorticoids prevent T-cell proliferation. During stress cytokines can also stimulate the secretion of CRF. However CRF can also regulate these cytokines. CRF has the potential to be used in the research into depression treatments.</p>Fórmula:C205H339N59O63SPureza:Min. 95%Peso molecular:4,670.3 g/mol
