Receptor Glucagon
Os receptores de glucagon são GPCRs que mediam os efeitos do glucagon, um hormônio envolvido na regulação da homeostase da glicose, promovendo a quebra de glicogênio e a liberação de glicose pelo fígado. Esses receptores são críticos na gestão dos níveis de açúcar no sangue e são de particular interesse no estudo do diabetes e distúrbios metabólicos. Antagonistas dos receptores de glucagon estão sendo explorados como potenciais tratamentos para hiperglicemia no diabetes tipo 2. Na CymitQuimica, oferecemos uma variedade de moduladores de receptores de glucagon de alta qualidade para apoiar sua pesquisa em endocrinologia, diabetes e regulação metabólica.
Foram encontrados 195 produtos de "Receptor Glucagon"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Avexitide acetate
CAS:Avexitide acetate (exendin 9-39) is a potent glucagon-like peptide 1 receptor (GLP-1R) antagonist for the study of post-obesity hypoglycemia.Fórmula:C155H246N40O53SPureza:96.64% - 98.65%Cor e Forma:SolidPeso molecular:3549.91PF-06882961
CAS:PF-06882961 is an orally bioavailable glucagon-like peptide-1 receptor (GLP-1R) agonist.Fórmula:C31H30FN5O4Pureza:97.19% - 99.56%Cor e Forma:SolidPeso molecular:555.6Volagidemab
CAS:<p>Anti-CD34 Antibody is a CHO-expressed humanized monoclonal antibody targeting CD34, which can be used for the study of neurological and cardiovascular diseases.</p>Pureza:97.8% (SDS-PAGE); 98% (SEC-HPLC) - 97.8% (SDS-PAGE); 98% (SEC-HPLC)Cor e Forma:LiquidRetatrutide
CAS:<p>Retatrutide (LY3437943) is a triple agonist of GCGR, GIPR and GLP-1R that can be used to study obesity.</p>Fórmula:C221H342N46O68Pureza:98.31%Cor e Forma:SolidPeso molecular:4732.09Tirzepatide monosodium salt
Tirzepatide sodium salt (LY3298176 sodium salt) is a GIP and GLP-1 receptor agonist with neuroprotective activity and can be used to treat obesity.Fórmula:C225H347N48O68NaPureza:99.69%Cor e Forma:SoildPeso molecular:4835.51Crotedumab
CAS:Crotedumab (REGN1193) is a humanized antibody targeting GCGR, which reduces fasting blood glucose and improves glucose tolerance, used in diabetes research.Pureza:>95%Cor e Forma:LiquidGlucagon (1-29), bovine, human, porcine hydrochloride
CAS:Glucagon (1-29), bovine, human, porcine hydrochloride is a peptide hormone, produced by pancreatic α-cells. Glucagon increases HNF4α phosphorylation.Fórmula:C153H225N43O49S·ClHPureza:95.65% - 98.03%Cor e Forma:SolidPeso molecular:3519.21Orforglipron
CAS:Orforglipron (LY3502970; GLP-1 receptor agonist 1) is an orally available glucagon-like peptide (GLP-1) receptor agonist for the study of obesity and type 1Fórmula:C48H48F2N10O5Pureza:99.47% - 99.8%Cor e Forma:SolidPeso molecular:882.96Retatrutide sodium salt
Retatrutide sodium salt is a glucagon receptor and glucagon-like peptide-1 receptor agonist for the study of type 2 diabetes mellitus.Pureza:99.97%Cor e Forma:SoildGLP-1R agonist 34
CAS:GLP-1R agonist 34 (Compound 1) is an orally active small molecule agonist of the glucagon-like peptide-1 receptor (GLP-1R). It enhances insulin secretion, suppresses glucagon release, and slows gastric emptying, thereby effectively reducing blood glucose levels. GLP-1R agonist 34 holds potential for research into metabolic disorders such as type 2 diabetes, obesity, and non-alcoholic steatohepatitis (NASH).Fórmula:C50H50F2N10O5Cor e Forma:SolidPeso molecular:908.99GLP-1R Agonist DMB
CAS:GLP-1R Agonist DMB is an agonist of glucagon-like peptide 1 receptor (GLP-1R; KB = 26.3 nM for the recombinant human receptor).Fórmula:C13H15Cl2N3O2SPureza:99.52%Cor e Forma:SolidPeso molecular:348.25GLP-1R Antagonist 1
CAS:<p>GLP-1R Antagonist 1 is an orally active, CNS penetrant and non-competitive glucagon-like peptide 1 receptor (GLP-1R) antagonist (IC50: 650 nM).</p>Fórmula:C16H11ClF6N4O2Pureza:99.84%Cor e Forma:SolidPeso molecular:440.73HAEGTFTSD
CAS:HAEGTFTSD is GLP-1's initial segment; GLP-1 (7-36) amide, tied to food intake, stems from preproglucagon in L-cells.Fórmula:C40H57N11O17Pureza:98%Cor e Forma:SolidPeso molecular:963.94Tirzepatide
CAS:Tirzepatide (LY-3298176) is a dual glucose-dependent polypeptide (GIP) (EC50=0.042 nM) and glucagon-like peptide-1 (GLP-1) (EC50=0.086 nM) receptor agonist.Fórmula:C225H348N48O68Pureza:99.52% - 99.99%Cor e Forma:SolidPeso molecular:4813.45HAEGT
CAS:<p>HAEGT is the first N-terminal 1-5 residues of GLP-1 peptide.</p>Fórmula:C20H31N7O9Pureza:98%Cor e Forma:SolidPeso molecular:513.5Glucagon receptor antagonists-1
CAS:Glucagon receptor antagonist -1 is a highly effective glucagon receptor antagonist.Fórmula:C29H34FNO2Pureza:98%Cor e Forma:SolidPeso molecular:447.58V-0219 hydrochloride
<p>V-0219 hydrochloride: oral GLP-1R PAM for obesity-linked diabetes study.</p>Fórmula:C20H26ClF3N4O2Pureza:99.97%Cor e Forma:SoildPeso molecular:446.89GLP-1 moiety from Dulaglutide
GLP-1 moiety from Dulaglutide is a 31-amino acid fragment of Dulaglutide which is a glucagon-like peptide 1 receptor (GLP-1) agonist.Fórmula:C149H221N37O49Pureza:98%Cor e Forma:SolidPeso molecular:3314.62HAEGTFTSD acetate(926018-45-3 free base)
HAEGTFTSD acetate is the first N-terminal 1-9 residues of GLP-1 peptide.The GLP-1 (7-36) amide is a product of the preproglucagon gene, which is secreted fromFórmula:C42H61N11O19Pureza:98%Cor e Forma:SolidPeso molecular:1024.01GLP-1 receptor agonist 13
Compound (S)-9, a GLP-1 receptor agonist, exhibits an EC50 of 76 nM for the glucagon GLP-1 receptor [1].Fórmula:C25H23ClF2N6OCor e Forma:SolidPeso molecular:496.94Albiglutide Fragment
CAS:<p>Albiglutide fragment is a 30-amino-acid sequence of modified human GLP-1 (fragment 7-36).</p>Fórmula:C148H224N40O45Pureza:98%Cor e Forma:SolidPeso molecular:3283.66α-Methylprednisolone 21-hemisuccinate sodium salt
CAS:6α-Methylprednisolone 21-hemisuccinate sodium salt (Asmacortone), a water-soluble ester, is used for allergic, cardiac, and hypoxic emergencies.Fórmula:C26H33NaO8Pureza:99.65%Cor e Forma:Lyophilized PowderPeso molecular:496.53Cinnamtannin A2
CAS:<p>Cinnamtannin A2, a tetrameric procyanidin, boosts GLP-1, insulin, CRH expression, and has antioxidant, anti-diabetic, nephroprotective properties.</p>Fórmula:C60H50O24Cor e Forma:SolidPeso molecular:1155.02Tirzepatide hydrochloride
Tirzepatide HCl is a dual GIP and GLP-1 receptor agonist.Fórmula:C225H349N48O68ClPureza:98%Cor e Forma:SolidPeso molecular:4849.91Survodutide TFA
Survodutide TFA (BI 456906 TFA) is a GCGR/GLP-1R dual agonist, a peptide compound used in obesity research.Fórmula:C192H289N47O61·xC2HF3OC2Pureza:99.29% - 99.96%Cor e Forma:SolidPeso molecular:4231.62 (free base)Secretin (28-54), human TFA
<p>Secretin (28-54), human TFA is a 27-amino acid peptide that works on the human Secretin receptor.</p>Fórmula:C132H221N44F3O42Pureza:98%Cor e Forma:SolidPeso molecular:3153.48VU0453379
CAS:VU0453379 is a highly selective and central nervous system penetrant positive allosteric modulator of glucagon-like peptide-1R (EC50: 1.3 μM).Fórmula:C26H34N4O2Pureza:98%Cor e Forma:SolidPeso molecular:434.57GLP-1 receptor agonist 4
CAS:GLP-1 receptor agonist 4 targets GLP-1R, EC50 64.5 nM, potential diabetes treatment research.Fórmula:C51H44Cl2N4O6Pureza:98%Cor e Forma:SolidPeso molecular:879.82Glucagon (19-29), human
CAS:Glucagon, a 29-amino-acid hormone, is produced by alpha cells in the pancreas' islets of Langerhans.Fórmula:C61H89N15O18SPureza:98%Cor e Forma:SolidPeso molecular:1352.53Glucagon-like peptide 1 (1-37), human
CAS:<p>Human GLP-1 (1-37) is a potent GLP-1 receptor agonist without impact on rat food intake or insulin secretion.</p>Fórmula:C186H275N51O59Pureza:98%Cor e Forma:SolidPeso molecular:4169.48Secretin (28-54), human
CAS:Secretin (28-54), human, is a 27-amino acid residue peptide with a C-terminal amidation, acting on human secretin receptors.Fórmula:C130H220N44O40Pureza:98%Cor e Forma:PowderPeso molecular:3039.46Albenatide
CAS:<p>Albenatide is a modified analog of exendin 4 conjugated to recombinant human albumin.</p>Fórmula:C26H47N7O9SPureza:98%Cor e Forma:SolidPeso molecular:633.76HAEGTFTSDVS
CAS:HAEGTFTSDVS is the first N-terminal 1-11 residues of GLP-1 peptide.Fórmula:C48H71N13O20Pureza:98%Cor e Forma:SolidPeso molecular:1150.18Pal-Glu(OSu)-OH
CAS:<p>Pal-Glu(OSu)-OH is a Liraglutide side chain, a GLP-1 agonist for type 2 diabetes study.</p>Fórmula:C25H42N2O7Cor e Forma:SolidPeso molecular:482.618TT-OAD2
CAS:<p>TT-OAD2 is a non-peptide agonist of glucagon-like peptide-1 (GLP-1) receptor (EC50: 5 nM), with the potential for diabetes treatment.</p>Fórmula:C50H49Cl4N3O6Pureza:98%Cor e Forma:SolidPeso molecular:929.75GLP-2(1-33)(human)
CAS:GLP-2(1-33) (human) is an enteroendocrine hormone which stimulates the growth of the intestinal epithelium.Fórmula:C165H254N44O55SPureza:98%Cor e Forma:SolidPeso molecular:3766.19HAEGTFT
CAS:HAEGTFT is the first N-terminal 1-7 residues of GLP-1 peptide.Fórmula:C33H47N9O12Pureza:98%Cor e Forma:SolidPeso molecular:761.78SDV-Exendin-3/4
SDV-Exendin-3/4 is a 32-amino acid peptide.Fórmula:NAPureza:98%Cor e Forma:SolidPeso molecular:3443.87Acmopatide
CAS:Acmopatide (Compound E-153) is a dual agonist of GIP and GLP-1 receptors and can be utilized in diabetes research.Cor e Forma:SolidGTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Peso molecular:3850.31Glucagon Receptor Antagonist Inactive Control
CAS:Glucagon Receptor Antagonist Inactive Control is a Glucagon receptor antagonist that can be used in related research in the field of life sciences.Fórmula:C21H23BrN2OSCor e Forma:SolidPeso molecular:431.39TE-8105
TE-8105 is a GLP-1 receptor agonist that demonstrates prolonged and enhanced efficacy in models of diabetes, obesity, and non-alcoholic steatohepatitis (NASH).Cor e Forma:Odour SolidZovaglutide
CAS:Zovaglutide is a GLP-1 receptor agonist that is utilized in diabetes research.Cor e Forma:Solid[Gly8]-GLP-1(7-37) acetate
[Gly8]-GLP-1(7-37) acetate is a derivative of GLP-1, where glycine at position 8 is replaced with alanine. [Gly8]-GLP-1(7-37) acetate is also a peptide fragment of the GLP-1 receptor (GLP-1R) agonist, Dulaglutide.Cor e Forma:Odour SolidWB4-24
CAS:WB4-24 is a GLP-1 receptor agonist that enhances the release of β-endorphin in microglia. It exhibits antiallodynic, anti-inflammatory, and analgesic effects in mouse models of inflammation induced by formalin, carrageenan, and CFA.Fórmula:C52H48N4O14S2Cor e Forma:SolidPeso molecular:1017.09Berobenatide
CAS:Berobenatide is a glucagon-like peptide-1 (GLP-1) receptor agonist.Cor e Forma:SolidPeptide C105Y TFA
Peptide C105Y TFA is a cell-penetrating peptide synthesized based on the amino acid sequence of residues 359-374 of α1-antitrypsin. It enhances the gene expression of DNA nanoparticles.Fórmula:C97H148N20O23S·xC2HF3O2GLP-1R agonist 20
GLP-1R agonist 20 (Compound I-132) is an agonist of the glucagon-like peptide-1 receptor (GLP-1 receptor), with an EC50 value of 0.0162 nM.Fórmula:C31H30Cl2F2N4O5Peso molecular:646.15613SPN009
SPN009 (Sequence 3) is a GLP-1 receptor (GLP-1 Receptor) agonist, with an EC50 of 2.84 nM, and improves type 2 diabetes in DB/DB mouse models.Fórmula:C191H299N45O59Peso molecular:4167.17798Anti-GLP-1R Antibody
Anti-GLP-1R Antibody is an anti-GLP-1R antibody that can be used for immunohistochemistry of paraffin sections.Pureza:98.3% (SDS-PAGE); 97.2% (SEC-HPLC) - 98.3% (SDS-PAGE); 97.2% (SEC-HPLC)Cor e Forma:Odour LiquidSecretin, canine TFA
Secretin, canine TFA, is an endocrine hormone that stimulates the secretion of pancreatic fluid rich in bicarbonate. Additionally, Secretin, canine TFA, can regulate the primary cell functions and paracellular permeability of gastric monolayer cells through an Src kinase-dependent pathway.Cor e Forma:Odour SolidSorbinicate
CAS:<p>Sorbinicate is an antihypercholesterolaemic and vasodilating nicotinic acid ester.</p>Fórmula:C42H32N6O12Pureza:98%Cor e Forma:SolidPeso molecular:812.74Semaglutide, FITC labeled
Semaglutide (FITC-labeled Semaglutide) is a long-acting analog of human glucagon-like peptide-1, functioning as an agonist of the GLP-1 receptor. It shows potential for research related to type 2 diabetes.Fórmula:C209H304N46O63SPeso molecular:4498.17191GIP/GLP-1 dual receptor agonist-1 sodium
GIP/GLP-1 dual receptor agonist-1 (Compound 4) (sodium) functions as a GIP/GLP-1 receptor agonist. This compound is applicable for research into metabolic disorders and liver diseases, including non-alcoholic steatohepatitis (NASH) and non-alcoholic fatty liver disease (NAFLD).Cor e Forma:Odour SolidGLP-1(7-36), amide acetate
CAS:GLP-1(7-36), amide acetate is a derivative of GLP-1 peptide , activate the GLP-1 receptor, promote insulin secretion,Type 2 diabetes mellitus and obesity.Fórmula:C151H230N40O47Pureza:99.89%Cor e Forma:SolidPeso molecular:3357.68Apraglutide
CAS:Apraglutide (FE 203799 is a synthetic 33-amino acid peptide and long-acting glp-2 analogue.Fórmula:C172H263N43O52Pureza:98%Cor e Forma:SolidPeso molecular:3765.25Dulaglutide
CAS:<p>Dulaglutide (LY2189265) is a GLP-1 receptor agonist for studying type 2 diabetes mellitus (T2DM).</p>Cor e Forma:SolidTaspoglutide
CAS:Taspoglutide is a long-acting glucagon-like peptide 1 (GLP-1) receptor agonist(EC50 value of 0.06 nM),and for treatment of type 2 diabetesFórmula:C152H232N40O45Pureza:98%Cor e Forma:SolidPeso molecular:3339.763LSN3160440
CAS:LSN3160440 is a GLP-1R allosteric modulator and PPI stabilizer aiding inactive GLP-1 attachment.Fórmula:C27H27Cl2N3OCor e Forma:SolidPeso molecular:480.43Des His1, Glu8 Exendin-4
Des His1, Glu8 Exendin-4 is a glucagon-like peptide-1 receptor (GLP1R) antagonist that regulates blood glucose and is used in the study of diabetes and obesity.Fórmula:C179H277N47O59SPureza:99.92%Cor e Forma:SolidPeso molecular:4063.46Secretin, porcine
CAS:Porcine secretin: 27-amino acid peptide for diagnosing pancreatic dysfunction and gastrinoma, stimulates bicarbonate fluid.Fórmula:C130H220N44O41·xC2H4O2Pureza:98%Cor e Forma:SolidPeso molecular:N/ATT-OAD2 free base
CAS:TT-OAD2 free base, a non-peptide GLP-1 receptor agonist, can treat diabetes; has an EC50 of 5 nM.Fórmula:C50H47Cl2N3O6Pureza:98%Cor e Forma:SolidPeso molecular:856.83{Val1}-Exendin-3/4
{Val1}- exendin-3/4 is the first n-terminal 1-28 residue of exendin-4 peptide.Fórmula:NAPureza:98%Cor e Forma:SolidPeso molecular:3241.7GLP-1R agonist 14
CAS:GLP-1R agonist 14, also known as Compound 14, is a potent agonist of the GLP-1 receptor, demonstrating an EC50 range of 0-20 nM against human GLP-1 [1].Fórmula:C45H42F2N10O5Cor e Forma:SolidPeso molecular:840.88GIP/GLP-1 dual receptor agonist-1
CAS:Compound 4: GIP/GLP-1 agonist for metabolic/fatty liver disease research.Cor e Forma:SolidHAEGTFTSDVS acetate
HAEGTFTSDVS acetate is the first N-terminal 1-11 residues of GLP-1 which stimulates insulin secretion from pancreatic β-cells.Fórmula:C50H75N13O22Pureza:97.47%Cor e Forma:SolidPeso molecular:1210.2GLP-1R agonist 29
<p>GLP-1R agonist 29 (Compound 20) is a GLP-1R agonist that induces hGLP-1R-mediated cAMP stimulation with an EC50 of 0.018 nM. It exhibits favorable pharmacokinetic properties and shows good in vivo exposure, with an AUC0-∞,sc of 77688 ng·h/mL.</p>Cor e Forma:Odour SolidExendin-3/4 (59-86)
Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.Fórmula:NAPureza:98%Cor e Forma:SolidPeso molecular:3055.49GLP-1(7-37)
CAS:GLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells.Fórmula:C151H228N40O47Pureza:98%Cor e Forma:SolidPeso molecular:3355.67Mazdutide acetate(2259884-03-0 free base)
Mazdutide acetate is a potent (GLP-1R and GCGR agonist that stimulates insulin secretion from mouse pancreatic islets , which can be used to study obesity.Pureza:98.41%Cor e Forma:Odour SolidBay 55-9837
CAS:Selective VPAC2 agonist; EC50: 0.4 nM (VPAC2), 100 nM (VPAC1), >1000 nM (PAC1). Enhances insulin secretion, reduces HIV-1 replication.Fórmula:C167H270N52O46Pureza:98%Cor e Forma:SolidPeso molecular:3742.29Semaglutide TFA
<p>Semaglutide TFA is a glucagon-like peptide-1 congener that induces weight loss, lowers blood glucose levels and reduces cardiovascular risk in diabetic patients</p>Fórmula:C189H290F3N45O61Pureza:99.69%Cor e Forma:SolidPeso molecular:4225.6482Survodutide
CAS:Survodutide (BI 456906) is a dual agonist of glucagon and glucagon-like peptide 1 (GLP-1) receptor (GLP Receptor) that reduces body weight in HbA1c16 diabetes.Fórmula:C192H289N47O61Pureza:99.83%Cor e Forma:SolidPeso molecular:4229.0957VU0453379 hydrochloride
VU0453379 hydrochloride: selective CNS-penetrant GLP-1R PAM, EC50 1.3 μM.Fórmula:C26H35ClN4O2Cor e Forma:SolidPeso molecular:471.033-Deoxyglucosone
CAS:3-Deoxyglucosone(3-Deoxy-D-glucosone) is synthesized by the intermediate pathway of the melad and polyol reactions.3-Deoxyglucosone reacts rapidly with proteinFórmula:C6H10O5Pureza:95%Cor e Forma:SolidPeso molecular:162.14Ribupatide
CAS:Ribupatide is a dual agonist of gastric inhibitory polypeptide (GIP) and glucagon-like peptide 1 (GLP-1) receptors and can be utilized in antidiabetic research.Cor e Forma:SolidAlbiglutide fragment TFA
Albiglutide fragment (GLP-1 (7-36) analog) TFA represents a biologically active segment of Albiglutide, resistant to DPP-4 degradation due to its structure as aFórmula:C148H224N40O45·xC2HF3O2Cor e Forma:SolidVensemaglutide
CAS:Vensemaglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist, utilized in research related to diabetes or other metabolic disorders.Fórmula:C214H337N49O67Peso molecular:4668.25(R)-V-0219 hydrochloride
(R)-V-0219 hydrochloride: Oral GLP-1R PAM, enantiomer of V-0219, triggers Ca2+ flux in hGLP-1R HEK cells.Fórmula:C20H26ClF3N4O2Cor e Forma:SolidPeso molecular:446.89GLP-1R agonist 26
CAS:Compound 1, also known as GLP-1R agonist 26, is an agonist of the glucagon-like peptide-1 receptor (GLP-1R) with an EC50 of <10 nM.Fórmula:C32H29FN6O4SPeso molecular:612.67Maridebart
CAS:Maridebart is a humanized IgG1-kappa monoclonal antibody that targets the GIPR (gastric inhibitory polypeptide receptor) [1].Cor e Forma:LiquidOxyntomodulin
CAS:GLP-1 analog modulates appetite, boosts metabolism, and curbs gastric acid. Increases cAMP, mildly stimulates glucagon receptor.Fórmula:C192H295N59O60SPureza:98%Cor e Forma:SolidPeso molecular:4421.86GLP-1 receptor agonist 8
CAS:GLP-1 receptor agonist 8, potent for diabetes and obesity research, may also study NAFLD.Fórmula:C34H36ClFN6O4Cor e Forma:SolidPeso molecular:647.14[Des-His1,Glu9]-Glucagon amide
CAS:Glucagon blocker with pA2 of 7.2; no agonist effect. Boosts insulin; prevents glucagon-driven hyperglycemia in rabbits and diabetic rats.Fórmula:C148H221N41O47SPureza:98%Cor e Forma:SolidPeso molecular:3358.68GLP-1R agonist 27
<p>GLP-1R agonist 27 (compound 21) is a potent and orally active GLP-1R agonist. It enhances the accumulation of cyclic adenosine monophosphate (cAMP), reduces blood glucose levels, and decreases food intake. GLP-1R agonist 27 shows potential for research in obesity and type 2 diabetes mellitus (T2DM).</p>Fórmula:C32H33N5O4SeCor e Forma:SolidPeso molecular:630.6Liraglutide acetate
CAS:Liraglutide acetate is the acetate salt form of Liraglutide, which is a glucagon-like peptide-1 (GLP-1) receptor agonist, utilized in the study of type 2 diabetes.Fórmula:C172H265N43O51·xC2H4O2Peso molecular:3751.20 (free base)(S)-V-0219 hydrochloride
(S)-V-0219 hydrochloride, a GLP-1R PAM, triggers calcium in hGLP-1R HEK cells, lowers glucose in mice, and reduces fasting hunger.Fórmula:C20H26ClF3N4O2Cor e Forma:SolidPeso molecular:446.89GLP-1R agonist 15
CAS:GLP-1R agonist 15 (Compound 101) is a GLP-1 receptor agonist [1] .Fórmula:C46H47FN8O7SCor e Forma:SolidPeso molecular:874.98Gulgafafusp alfa
CAS:Gulgafafusp alfa is a human IgG2κ monoclonal antibody that selectively binds to the glucagon-like peptide 1 receptor (GLP1R) [1].Cor e Forma:LiquidPHI-27 (porcine)
CAS:PHI-27 (porcine) is a porcine-derived peptide consisting of 27 amino acids, utilized in the identification of peptide hormones and other bioactive peptides [1].Fórmula:C136H216N36O40Peso molecular:2995.39DD202-114
CAS:DD202-114 is an effective and selective agonist of GLP1R. It promotes the accumulation of cAMP, reduces blood glucose levels, and decreases food intake. Additionally, DD202-114 holds potential for research in type 2 diabetes mellitus (T2DM) and obesity studies.Fórmula:C33H35FN4O5Peso molecular:586.65Glucagon-like peptide 1 (1-37), human TFA
Human Glucagon-like peptide 1 (1-37) TFA is a potent GLP-1 receptor agonist derived from proglucagon.Fórmula:C188H276N51F3O61Pureza:98%Cor e Forma:SolidPeso molecular:4283.5(Asp28)-Glucagon (1-29) (human, rat, porcine)
CAS:"(Asp28)-Glucagon (1-29) (human, rat, porcine)" is an analog of glucagon with an aspartic acid (Asp) substitution at position 28, notably enhancing its aqueousFórmula:C153H224N42O50SPeso molecular:3483.73GLP-1R agonist 16
CAS:Compound 115a, a GLP-1R agonist, effectively activates the GLP-1 receptor with an EC50 of 0.15 nM [1].Fórmula:C50H58FN10O6PCor e Forma:SolidPeso molecular:945.03GLP-1R agonist 4
CAS:GLP-1R agonist 4, potentially for diabetes research, is a potent GLP-1R stimulator linked to hypoglycemia.Fórmula:C32H30ClF2N3O5Cor e Forma:SolidPeso molecular:610.05SAR441255
SAR441255 is a potent unimolecular peptide that acts as a GLP-1/GIP/GCG receptor triagonist, demonstrating balanced activation across all three target receptorsCor e Forma:Odour SolidFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Cor e Forma:SolidPeso molecular:3692.15Dapiglutide
CAS:Dapiglutide (ZP7570) is a long-acting GLP-1R & GLP-2R dual agonist for SBS research.Cor e Forma:SolidGRPP (human)
CAS:GRPP (human), a 30-amino-acid peptide derived from Gcg, modestly elevates plasma insulin levels while reducing plasma glucagon concentrations.Fórmula:C136H215N41O58SCor e Forma:SolidPeso molecular:3384.47GLP-1(28-36)amide TFA
GLP-1(28-36)amide TFA, a nonapeptide cleavage product of GLP-1, shows antioxidant properties with anti-diabetic and cardioprotective effects.Fórmula:C56H86F3N15O11Cor e Forma:SolidPeso molecular:1202.37
![[Des-His1,Glu9]-Glucagon amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2033.webp&w=3840&q=75)
