Receptor Glucagon
Os receptores de glucagon são GPCRs que mediam os efeitos do glucagon, um hormônio envolvido na regulação da homeostase da glicose, promovendo a quebra de glicogênio e a liberação de glicose pelo fígado. Esses receptores são críticos na gestão dos níveis de açúcar no sangue e são de particular interesse no estudo do diabetes e distúrbios metabólicos. Antagonistas dos receptores de glucagon estão sendo explorados como potenciais tratamentos para hiperglicemia no diabetes tipo 2. Na CymitQuimica, oferecemos uma variedade de moduladores de receptores de glucagon de alta qualidade para apoiar sua pesquisa em endocrinologia, diabetes e regulação metabólica.
Foram encontrados 164 produtos de "Receptor Glucagon"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
TT-OAD2
CAS:<p>TT-OAD2 is a non-peptide agonist of glucagon-like peptide-1 (GLP-1) receptor (EC50: 5 nM), with the potential for diabetes treatment.</p>Fórmula:C50H49Cl4N3O6Pureza:98%Cor e Forma:SolidPeso molecular:929.75GLP-2(1-33)(human)
CAS:<p>GLP-2(1-33) (human) is an enteroendocrine hormone which stimulates the growth of the intestinal epithelium.</p>Fórmula:C165H254N44O55SPureza:98%Cor e Forma:SolidPeso molecular:3766.19HAEGTFT
CAS:<p>HAEGTFT is the first N-terminal 1-7 residues of GLP-1 peptide.</p>Fórmula:C33H47N9O12Pureza:98%Cor e Forma:SolidPeso molecular:761.78GLP-1(7-36), amide acetate
CAS:<p>GLP-1(7-36), amide acetate is a derivative of GLP-1 peptide , activate the GLP-1 receptor, promote insulin secretion,Type 2 diabetes mellitus and obesity.</p>Fórmula:C151H230N40O47Pureza:99.89%Cor e Forma:SolidPeso molecular:3357.68Apraglutide
CAS:<p>Apraglutide (FE 203799 is a synthetic 33-amino acid peptide and long-acting glp-2 analogue.</p>Fórmula:C172H263N43O52Pureza:98%Cor e Forma:SolidPeso molecular:3765.25Dulaglutide
CAS:<p>Dulaglutide (LY2189265) is a GLP-1 receptor agonist for studying type 2 diabetes mellitus (T2DM).</p>Cor e Forma:SolidTaspoglutide
CAS:<p>Taspoglutide is a long-acting glucagon-like peptide 1 (GLP-1) receptor agonist(EC50 value of 0.06 nM),and for treatment of type 2 diabetes</p>Fórmula:C152H232N40O45Pureza:98%Cor e Forma:SolidPeso molecular:3339.763LSN3160440
CAS:<p>LSN3160440 is a GLP-1R allosteric modulator and PPI stabilizer aiding inactive GLP-1 attachment.</p>Fórmula:C27H27Cl2N3OCor e Forma:SolidPeso molecular:480.43Des His1, Glu8 Exendin-4
<p>Des His1, Glu8 Exendin-4 is a glucagon-like peptide-1 receptor (GLP1R) antagonist that regulates blood glucose and is used in the study of diabetes and obesity.</p>Fórmula:C179H277N47O59SPureza:99.92%Cor e Forma:SolidPeso molecular:4063.46Secretin, porcine
CAS:<p>Porcine secretin: 27-amino acid peptide for diagnosing pancreatic dysfunction and gastrinoma, stimulates bicarbonate fluid.</p>Fórmula:C130H220N44O41·xC2H4O2Pureza:98%Cor e Forma:SolidPeso molecular:N/ATT-OAD2 free base
CAS:<p>TT-OAD2 free base, a non-peptide GLP-1 receptor agonist, can treat diabetes; has an EC50 of 5 nM.</p>Fórmula:C50H47Cl2N3O6Pureza:98%Cor e Forma:SolidPeso molecular:856.83{Val1}-Exendin-3/4
<p>{Val1}- exendin-3/4 is the first n-terminal 1-28 residue of exendin-4 peptide.</p>Fórmula:NAPureza:98%Cor e Forma:SolidPeso molecular:3241.7GLP-1R agonist 14
CAS:<p>GLP-1R agonist 14, also known as Compound 14, is a potent agonist of the GLP-1 receptor, demonstrating an EC50 range of 0-20 nM against human GLP-1 [1].</p>Fórmula:C45H42F2N10O5Cor e Forma:SolidPeso molecular:840.88GIP/GLP-1 dual receptor agonist-1
CAS:<p>Compound 4: GIP/GLP-1 agonist for metabolic/fatty liver disease research.</p>Cor e Forma:SolidHAEGTFTSDVS acetate
<p>HAEGTFTSDVS acetate is the first N-terminal 1-11 residues of GLP-1 which stimulates insulin secretion from pancreatic β-cells.</p>Fórmula:C50H75N13O22Pureza:97.47%Cor e Forma:SolidPeso molecular:1210.2GLP-1R agonist 29
<p>GLP-1R agonist 29 (Compound 20) is a GLP-1R agonist that induces hGLP-1R-mediated cAMP stimulation with an EC50 of 0.018 nM. It exhibits favorable pharmacokinetic properties and shows good in vivo exposure, with an AUC0-∞,sc of 77688 ng·h/mL.</p>Cor e Forma:Odour SolidExendin-3/4 (59-86)
<p>Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.</p>Fórmula:NAPureza:98%Cor e Forma:SolidPeso molecular:3055.49GLP-1(7-37)
CAS:<p>GLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells.</p>Fórmula:C151H228N40O47Pureza:98%Cor e Forma:SolidPeso molecular:3355.67Mazdutide acetate(2259884-03-0 free base)
<p>Mazdutide acetate is a potent (GLP-1R and GCGR agonist that stimulates insulin secretion from mouse pancreatic islets , which can be used to study obesity.</p>Pureza:98.41%Cor e Forma:Odour SolidBay 55-9837
CAS:<p>Selective VPAC2 agonist; EC50: 0.4 nM (VPAC2), 100 nM (VPAC1), >1000 nM (PAC1). Enhances insulin secretion, reduces HIV-1 replication.</p>Fórmula:C167H270N52O46Pureza:98%Cor e Forma:SolidPeso molecular:3742.29Semaglutide TFA
<p>Semaglutide TFA is a glucagon-like peptide-1 congener that induces weight loss, lowers blood glucose levels and reduces cardiovascular risk in diabetic patients</p>Fórmula:C189H290F3N45O61Pureza:99.69%Cor e Forma:SolidPeso molecular:4225.6482Survodutide
CAS:<p>Survodutide (BI 456906) is a dual agonist of glucagon and glucagon-like peptide 1 (GLP-1) receptor (GLP Receptor) that reduces body weight in HbA1c16 diabetes.</p>Fórmula:C192H289N47O61Pureza:99.83%Cor e Forma:SolidPeso molecular:4229.0957VU0453379 hydrochloride
<p>VU0453379 hydrochloride: selective CNS-penetrant GLP-1R PAM, EC50 1.3 μM.</p>Fórmula:C26H35ClN4O2Cor e Forma:SolidPeso molecular:471.033-Deoxyglucosone
CAS:<p>3-Deoxyglucosone(3-Deoxy-D-glucosone) is synthesized by the intermediate pathway of the melad and polyol reactions.3-Deoxyglucosone reacts rapidly with protein</p>Fórmula:C6H10O5Pureza:95%Cor e Forma:SolidPeso molecular:162.14Sorbinicate
CAS:<p>Sorbinicate is an antihypercholesterolaemic and vasodilating nicotinic acid ester.</p>Fórmula:C42H32N6O12Pureza:98%Cor e Forma:SolidPeso molecular:812.74Albiglutide fragment TFA
<p>Albiglutide fragment (GLP-1 (7-36) analog) TFA represents a biologically active segment of Albiglutide, resistant to DPP-4 degradation due to its structure as a</p>Fórmula:C148H224N40O45·xC2HF3O2Cor e Forma:Solid(R)-V-0219 hydrochloride
<p>(R)-V-0219 hydrochloride: Oral GLP-1R PAM, enantiomer of V-0219, triggers Ca2+ flux in hGLP-1R HEK cells.</p>Fórmula:C20H26ClF3N4O2Cor e Forma:SolidPeso molecular:446.89Maridebart
CAS:<p>Maridebart is a humanized IgG1-kappa monoclonal antibody that targets the GIPR (gastric inhibitory polypeptide receptor) [1].</p>Cor e Forma:LiquidOxyntomodulin
CAS:<p>GLP-1 analog modulates appetite, boosts metabolism, and curbs gastric acid. Increases cAMP, mildly stimulates glucagon receptor.</p>Fórmula:C192H295N59O60SPureza:98%Cor e Forma:SolidPeso molecular:4421.86GLP-1 receptor agonist 8
CAS:<p>GLP-1 receptor agonist 8, potent for diabetes and obesity research, may also study NAFLD.</p>Fórmula:C34H36ClFN6O4Cor e Forma:SolidPeso molecular:647.14[Des-His1,Glu9]-Glucagon amide
CAS:<p>Glucagon blocker with pA2 of 7.2; no agonist effect. Boosts insulin; prevents glucagon-driven hyperglycemia in rabbits and diabetic rats.</p>Fórmula:C148H221N41O47SPureza:98%Cor e Forma:SolidPeso molecular:3358.68GLP-1R agonist 27
<p>GLP-1R agonist 27 (compound 21) is a potent and orally active GLP-1R agonist. It enhances the accumulation of cyclic adenosine monophosphate (cAMP), reduces blood glucose levels, and decreases food intake. GLP-1R agonist 27 shows potential for research in obesity and type 2 diabetes mellitus (T2DM).</p>Fórmula:C32H33N5O4SeCor e Forma:SolidPeso molecular:630.6(S)-V-0219 hydrochloride
<p>(S)-V-0219 hydrochloride, a GLP-1R PAM, triggers calcium in hGLP-1R HEK cells, lowers glucose in mice, and reduces fasting hunger.</p>Fórmula:C20H26ClF3N4O2Cor e Forma:SolidPeso molecular:446.89GLP-1R agonist 15
CAS:<p>GLP-1R agonist 15 (Compound 101) is a GLP-1 receptor agonist [1] .</p>Fórmula:C46H47FN8O7SCor e Forma:SolidPeso molecular:874.98Gulgafafusp alfa
CAS:<p>Gulgafafusp alfa is a human IgG2κ monoclonal antibody that selectively binds to the glucagon-like peptide 1 receptor (GLP1R) [1].</p>Cor e Forma:LiquidAnti-GLP-1R Antibody
<p>Anti-GLP-1R Antibody is an anti-GLP-1R antibody that can be used for immunohistochemistry of paraffin sections.</p>Pureza:98.3% (SDS-PAGE); 97.2% (SEC-HPLC) - 98.3% (SDS-PAGE); 97.2% (SEC-HPLC)Cor e Forma:Odour LiquidSPN009
<p>SPN009 (Sequence 3) is a GLP-1 receptor (GLP-1 Receptor) agonist, with an EC50 of 2.84 nM, and improves type 2 diabetes in DB/DB mouse models.</p>Fórmula:C191H299N45O59Peso molecular:4167.17798Glucagon-like peptide 1 (1-37), human TFA
<p>Human Glucagon-like peptide 1 (1-37) TFA is a potent GLP-1 receptor agonist derived from proglucagon.</p>Fórmula:C188H276N51F3O61Pureza:98%Cor e Forma:SolidPeso molecular:4283.5GLP-1R agonist 20
<p>GLP-1R agonist 20 (Compound I-132) is an agonist of the glucagon-like peptide-1 receptor (GLP-1 receptor), with an EC50 value of 0.0162 nM.</p>Fórmula:C31H30Cl2F2N4O5Peso molecular:646.15613GLP-1R agonist 16
CAS:<p>Compound 115a, a GLP-1R agonist, effectively activates the GLP-1 receptor with an EC50 of 0.15 nM [1].</p>Fórmula:C50H58FN10O6PCor e Forma:SolidPeso molecular:945.03GLP-1R agonist 4
CAS:<p>GLP-1R agonist 4, potentially for diabetes research, is a potent GLP-1R stimulator linked to hypoglycemia.</p>Fórmula:C32H30ClF2N3O5Cor e Forma:SolidPeso molecular:610.05SAR441255
<p>SAR441255 is a potent unimolecular peptide that acts as a GLP-1/GIP/GCG receptor triagonist, demonstrating balanced activation across all three target receptors</p>Cor e Forma:Odour SolidFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
<p>FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.</p>Cor e Forma:SolidPeso molecular:3692.15Dapiglutide
CAS:<p>Dapiglutide (ZP7570) is a long-acting GLP-1R & GLP-2R dual agonist for SBS research.</p>Cor e Forma:SolidGRPP (human)
CAS:<p>GRPP (human), a 30-amino-acid peptide derived from Gcg, modestly elevates plasma insulin levels while reducing plasma glucagon concentrations.</p>Fórmula:C136H215N41O58SCor e Forma:SolidPeso molecular:3384.47Glucagon (1-29), bovine, human, porcine
CAS:<p>Corynoxine B (Cory B) is a naturally occurring alkaloid isolated from Uncaria rhynchophylla (Miq. ) and is an autophagy inducer.</p>Fórmula:C153H225N43O49SPureza:99.56% - 99.56%Cor e Forma:SolidPeso molecular:3482.75GLP-1 receptor agonist 7
CAS:<p>GLP-1 receptor agonist 7, potential for diabetes research, from patent WO2021219019A1.</p>Fórmula:C31H30ClFN4O5Cor e Forma:SolidPeso molecular:593.05GLP-1 receptor agonist 2
CAS:<p>GLP-1 receptor agonist 2 is a glucagon-like peptide-1 receptor (GLP-1R) agonist.</p>Fórmula:C30H31ClFN5O4Cor e Forma:SolidPeso molecular:580.05V-0219
CAS:<p>V-0219 is a positive allosteric modulator of GLP-1 and can be used in studies about obesity-associated diabetes.</p>Fórmula:C20H25F3N4O2Pureza:99.91%Cor e Forma:SoildPeso molecular:410.43GLP-1R modulator C16
CAS:<p>GLP-1R modulator C16 is a variable modulator that significantly increases the binding affinity of GLP-4.</p>Fórmula:C21H26ClFN2O3Pureza:99.6% - >99.99%Cor e Forma:SolidPeso molecular:408.89
![[Des-His1,Glu9]-Glucagon amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2033.webp&w=3840&q=75)
