Bioquímicos e reagentes

<p>Please enquire for more information about Human Retinol Binding Protein ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hamster (CHO) Clusterin ELISA Kit<br>Clusterin plays key roles in protein homeostasis/proteostasis, and the modulation of pro-survival signaling networks.</p>

<p>Bovine/Cow CRP ELISA Kit - For the quantitative determination of c-reactive protein (CRP) in cow/bovine samples.</p>

<p>Ready to use Mouse C1q ELISA Kit</p>

<p>Please enquire for more information about Mouse Fibrinogen ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Canine/Dog SAA ELISA Kit - For the quantitative determination of serum amyloid A (SAA) in dog samples.</p>

<p>Chicken SAA ELISA Kit - For the quantitative determination of serum amyloid A (SAA) in chicken samples.</p>

<p>Please enquire for more information about Dog IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>Mouse monoclonal TPMT antibody</p>

<p>Bisoprolol is a peptide that binds to the beta-adrenergic receptor and is used as a research tool to study the pharmacology of this receptor. Bisoprolol is a selective beta-1 receptor antagonist, which can inhibit the activation of this receptor. It has been shown to inhibit tumor growth in mice by inhibiting protein interactions with cell membranes, which decreases calcium levels in cells. The main mechanism of action for bisoprolol is through inhibition of protein interactions with cell membranes, which leads to decreased intracellular calcium levels and subsequent inhibition of cellular processes such as protein synthesis.</p>

<p>RGH-5526 is a peptide that activates the immune system. It is an inhibitor of protein interactions and has been shown to inhibit receptor signaling, ligand binding, and ion channels. The peptide has also been shown to be a high-purity product with CAS No. 69579-13-1. This product can be used as a research tool in cell biology and pharmacology studies.</p>

<p>ELISA Kit for detection of IFNb in the research laboratory</p>

<p>ELISA kit for the detection of CA 199 in the research laboratory</p>

<p>The PCBP2 antibody is a highly specialized Polyclonal Antibody that has neutralizing properties against enzyme activities. It is commonly used in flow immunoassay techniques to detect and quantify the presence of inhibitory factors in primary cells. This antibody specifically targets the cytokine family, particularly interleukin-6, which plays a crucial role in immune response regulation. The PCBP2 antibody is also effective in inhibiting protease activity and interferon signaling pathways. Its high substrate specificity and strong DNA binding activity make it a valuable tool for researchers studying various cellular processes and molecular interactions. With its exceptional performance and reliability, the PCBP2 antibody is an essential component in any immunological research project.</p>

<p>ELISA kit for the detection of Histamine in foodstuffs in the research laboratory</p>

<p>ELISA kit for the detection of NGAL in the research laboratory</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>ELISA kit for the detection of Estradiol in the research laboratory</p>

<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>

<p>Antagonist of histamine receptor H4</p>

<p>Dog Alpha 1-Acid Glycoprotein ELISA Kit</p>

<p>Mouse TNF-alpha ELISA Kit</p>

<p>Leptin is a cell-signalling hormone vital in the regulation of appetite, food intake and body weight. Studies have shown that an absence of leptin in the body or leptin resistance can lead to uncontrolled feeding and weight gain. Because obesity is an established risk factor in various cancers and leptin plays a significant role in the physiopathology of obesity, the exploration of leptin's link to cancer risk is of considerable importance.</p>

<p>Dequalinium chloride hydrate is a molecule that is used to treat various types of cancer, such as breast, lung, and prostate cancers. It inhibits HDACs and has been shown to induce apoptosis in a number of cancer cell lines. The drug also prevents the accumulation of damaged DNA and reduces drug sensitivity, leading to increased survival rates in mice with cancer. Dequalinium chloride hydrate has been shown to inhibit mitochondrial membrane potential in muscle tissue, leading to apoptosis and necrosis. This drug may have some potential for use in treating cardiac conditions such as heart failure.</p>

<p>Cat SAA ELISA Kit - For the quantitative determination of serum amyloid A (SAA) in feline samples.</p>

<p>(4bS,8aS,9S,10S)-10-(Acetyloxy)-3,9-bis(benzoyloxy)-4b,5,6,7,8,8a,9,10-octahydro-4b,8,8-trimethyl-2-(1-methylethyl)-1,4-phenanthrene dione is a potent chemokine molecule that is an agonist of the CXCR2 receptor. It has been shown to inhibit cancer stem cells and chemoattractant production in colon carcinoma cells. This compound selectively targets the translation of lamiaceae mRNA and induces apoptosis in colon carcinoma cells.</p>

<p>ELISA Kit for detection of Prolactin in the research laboratory</p>

<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>ELISA Kit for detection of IgM in the research laboratory</p>

<p>ELISA kit for the detection of Thyroid peroxidase in the research laboratory</p>

<p>Custom research peptide; min purity 95%.</p>

<p>ELISA kit for the detection of Leptin Receptor in the research laboratory</p>

<p>ELISA kit for detection of CMV in the research laboratory</p>

<p>GPR116 antibody was raised in Rabbit using Human GPR116 as the immunogen</p>

<p>PEX5 antibody was raised using the middle region of PEX5 corresponding to a region with amino acids LNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLL</p>

<p>ELISA kit for detection of Serotonin in the research laboratory</p>

<p>ELISA Kit for detection of MMP1 in the research laboratory</p>

<p>ELISA kit for the detection of Jo1 in the research laboratory</p>

<p>ELISA Kit for detection of IL17 in the research laboratory</p>

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>Adrenaline/Noradrenaline/Dopamine ELISA Kit for the rapid quantitative determination of Adrenaline/Noradrenaline/Dopamine in plasma</p>

<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>

<p>Human HMGB1(High mobility group protein B1) ELISA Kit</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>Bovine Serum Albumin (BSA) is a protein that is used in the pharmaceutical industry as a research tool and an immunological reagent. BSA can be used to bind, stabilize, and prevent denaturation of other proteins in the laboratory. It has been shown to inhibit ion channels and ligand-gated ion channels, which are important for membrane potentials. BSA is also an activator of receptor tyrosine kinases, which are involved in cell signaling pathways.</p>

<p>ELISA Kit for detection of NGFb in the research laboratory</p>

<p>Purified recombinant Human DECR1 protein</p>

<p>ELISA kit for detection of Fibronectin in the research laboratory</p>

<p>ELISA kit for the detection of Dopamine in the research laboratory</p>

<p>ELISA Kit for detection of PGD2 in the research laboratory</p>

<p>ELISA kit for detection of CXCL10 in the research laboratory</p>

<p>ELISA kit for the detection of Human VEGF in the research laboratory</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>AMC is a peptide that acts as an activator of the nicotinic acetylcholine receptor. AMC is a high-purity, ion channel ligand with a CAS No. 26093-31-2. It is used in life science research to study cell biology and pharmacology. AMC has been shown to be an inhibitor of the enzyme acetylcholinesterase (AChE) in rat brain slices and it has been reported that it can inhibit the proliferation of human leukemia cells.END&gt;</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of P2RX2 antibody, catalog no. 70R-5171</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>ELISA kit for the detection of Toxoplasma gondii IgG in the research laboratory</p>

<p>ELISA kit for detection of Laminin in the research laboratory</p>

<p>ELISA Kit for detection of PDGFAB in the research laboratory</p>

<p>ELISA kit for the detection of Prothrombin IgG/IgM in the research laboratory</p>

<p>ELISA kit for detection of Rheumatoid Factor IgG in the research laboratory</p>

<p>Amelubant is a synthetic compound designed for use in detailed biochemical research and therapeutic investigations. As a product derived from innovative chemical synthesis techniques, Amelubant is engineered to interact with particular biological pathways, predominantly in the field of inflammatory response modulation. Its mode of action involves specific binding to target receptors, influencing downstream signaling cascades.</p>

<p>ELISA Kit for detection of MMP1 in the research laboratory</p>

<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>

<p>ELISA kit for detection of CD40 in the research laboratory</p>

<p>ELISA kit for the detection of Fibronectin in the research laboratory</p>

<p>ELISA Kit for detection of PGF2a in the research laboratory</p>

<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Mesotocin is a peptide hormone that has a role in the regulation of water permeability and estradiol benzoate. It also regulates the physiological functions of the brain and has been shown to be involved in congestive heart failure, as it causes an increase in blood pressure. Mesotocin is found at high levels in human serum, but its activity is dependent on the presence of other hormones such as estradiol benzoate. The biological properties of mesotocin are largely unknown, although it is known to have receptor activity. The effects of this hormone on the kidney have been studied using mesotocin trifluroacetate (MTFA) and monoclonal antibody (mAb). MTFA causes an increase in glomerular filtration rate (GFR), which may be due to its ability to inhibit angiotensin II-induced vasoconstriction and decrease vascular resistance.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.</p>

<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>

<p>Amyloid beta-Protein (36-38) is a peptide that has molecular weight of 4.3 kDa. It is a fragment of amyloid precursor protein, which is cleaved by enzymes in the brain to create the peptide. Amyloid beta-Protein (36-38) has been found to be involved in Alzheimer's disease as it aggregates into β-sheet bundles and forms amyloid plaques in the brain. This protein can be detected using vibrational spectroscopy and has been observed to have a strain that changes depending on pH. This molecule also undergoes proteolysis by peptidases, which break down proteins into amino acids for analysis with an amino acid analyzer. The solute can be analyzed with an acid analysis or spectrometer, which are used to determine functional groups such as carboxylic acids, hydroxyls, or amides. Amyloid beta-Protein (36-38)</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.</p>