Bioquímicos e reagentes

<p>ELISA kit for the detection of Human GCSF in the research laboratory</p>

<p>Please enquire for more information about Mouse SAA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Purified Mouse anti-Human Procalcitonin antibody (Clone 1B12)</p>

<p>ELISA kit for the detection of NGAL in the research laboratory</p>

<p>PBB 10 is a monoclonal antibody that binds to the antigen on the surface of cells. It is used in immunocytochemical staining and immunohistochemical staining techniques, as well as in ELISA assays. PBB 10 can be used for the detection of brominated biphenyls (PBBs) in liquid samples that are either incubated or not incubated with a brominating agent. PBB 10 can be used for the detection of polychlorinated biphenyls (PCBs) in dry samples that are debrominated before analysis. The antibody is also useful for detecting PCBs in tissues from laboratory animals. PBB 10 stains neural tissue and has been shown to be a ligand for certain receptors in the nervous system.</p>

<p>ELISA kit for the detection of Estradiol in the research laboratory</p>

<p>Rat Hemopexin ELISA Kit</p>

<p>Human Alpha 1-Acid Glycoprotein (AGP/Orosomucoid) ELISA Kit</p>

<p>ELISA kit for the detection of SSA in the research laboratory</p>

<p>Please enquire for more information about Mouse Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>

<p>ELISA Kit for detection of IgA in the research laboratory</p>

<p>Please enquire for more information about Human Alpha 1-Microglobulin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA Kit for detection of IgM in the research laboratory</p>

<p>ELISA kit for the detection of Gliadin IgG in the research laboratory</p>

<p>ELISA Kit for detection of IL17 in the research laboratory</p>

<p>Rat NGAL ELISA Kit</p>

<p>ELISA kit for detection of IGF1 in the research laboratory</p>

<p>ELISA Kit for detection of MIP3 alpha in the research laboratory</p>

<p>ELISA kit for the detection of Dengue Virus IgM in the research laboratory</p>

<p>ELISA kit for detection of Fibronectin in the research laboratory</p>

<p>ELISA kit for the detection of PR3  in the research laboratory</p>

<p>Please enquire for more information about Mouse IgG2B ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA Kit for detection of Oxytocin in the research laboratory</p>

<p>Inbred mouse strains such as C57BL/6, C57BL/10 and NOD with the Igh1-b allele do not have the gene for IgG2a and instead express the IgG2c isotype.</p>

<p>Portion of Influenza M</p>

<p>Please enquire for more information about Rat IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Horse IgM ELISA Kit</p>

<p>The Sheep IgG ELISA kit is intended for the quantitative determination of total sheep IgG in biological samples.</p>

<p>Mouse Fetuin/AHSG ELISA Kit.</p>

<p>Please enquire for more information about Human IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of Histamine release from heparinized whole blood in the research laboratory</p>

<p>Please enquire for more information about Fumaric acid-d4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dysprosium(III) bromide is an ionic compound that is an essential component of many high-temperature superconductors. This compound has a stoichiometric ratio of 1:1, which means that the number of dysprosium atoms in the formula is equal to the number of bromide ions. The experimental transport properties for this compound have been determined using a series of experiments. Transport activity coefficients and transition temperatures were calculated using quadratic equations. The solubility data for Dysprosium(III) bromide has been determined at several temperatures, as well as its eutectic point and melting point constants.</p>

<p>ELISA kit for the detection of Human VEGF in the research laboratory</p>

<p>Please enquire for more information about 3,7,11,15,19,23,27,31,35-nonamethyl-2E,6E,10E,34-hexatriacontatetraene-1,15,19,23,27,31-hexol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA Kit for detection of Prostaglandin E2 in the research laboratory</p>

<p>Hamster (CHO) Annexin A5 ELISA Kit<br> <br>Annexin A5 is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Annexin A5 is highly immunogenic and may cause dangerous adverse reactions if present in a therapeutic drug formulation.</p>

<p>NECAP1 antibody was raised in Rabbit using Human NECAP1 as the immunogen</p>

<p>ELISA Kit for detection of Leptin in the research laboratory</p>

<p>Dequalinium chloride hydrate is a molecule that is used to treat various types of cancer, such as breast, lung, and prostate cancers. It inhibits HDACs and has been shown to induce apoptosis in a number of cancer cell lines. The drug also prevents the accumulation of damaged DNA and reduces drug sensitivity, leading to increased survival rates in mice with cancer. Dequalinium chloride hydrate has been shown to inhibit mitochondrial membrane potential in muscle tissue, leading to apoptosis and necrosis. This drug may have some potential for use in treating cardiac conditions such as heart failure.</p>

<p>Human Novel Coronavirus Nucleoprotein (SARS-CoV-2 N) IgG Ab ELISA Kit</p>

<p>ELISA kit for the detection of TRAIL in the research laboratory</p>

<p>LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK</p>

<p>Rat Beta 2-Microglobulin ELISA Kit<br>Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.</p>

<p>ELISA kit for the detection of Annexin V in the research laboratory</p>

<p>ELISA kit for detection of MIF in the research laboratory</p>

<p>Horse Haptoglobin ELISA Kit</p>

<p>The Monkey IgM ELISA kit is intended for the quantitative determination of total monkey IgM (new and old world) in biological samples.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SYNCRIP antibody, catalog no. 70R-1335</p>

<p>TTC27 antibody was raised in rabbit using the N terminal of TTC27 as the immunogen</p>

<p>ELISA kit for the detection of Cardiolipin screen IgG/IgM/IgA1 in the research laboratory</p>

<p>ELISA kit for detection of BAFF in the research laboratory</p>

<p>Mouse Plasminogen ELISA Kit</p>

<p>ELISA kit for the detection of LH in the research laboratory</p>

<p>Please enquire for more information about Dog IgM ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of Gliadin IgA in the research laboratory</p>

<p>ELISA kit for the detection of Sperm Antibodies in the research laboratory</p>

<p>ELISA Kit for detection of MMP3 in the research laboratory</p>

<p>Grams iodine stain is a chemical reagent that is used to detect the presence of bacteria. It can be used on both leaves and human fecal samples. The procedure involves placing a small amount of bacteria on an agar plate. The bacteria are then stained with an iodine solution, which reacts with the fatty acids in the cell walls to produce a black precipitate. This process allows for the detection of bacterial colonies by their black color. The Gram stain is named after the Danish bacteriologist Hans Christian Gram, who developed it in 1884.</p>

<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (FITC)</p>

<p>ELISA Kit for detection of IgG in the research laboratory</p>

<p>Pig IgM ELISA Kit</p>

<p>A rapid immunoassay for the detection of Dog NGAL/Lipocalin-2;</p>

<p>ELISA kit for the detection of Centromere B in the research laboratory</p>

<p>ELISA Kit for detection of Free Thyroxine in the research laboratory</p>

<p>Rabbit IgM ELISA Kit</p>

<p>Bovine/Cow AGP ELISA Kit</p>

<p>ELISA kit for the detection of Human VEGF in the research laboratory</p>

<p>ELISA kit for the detection of Rat/Mouse Corticosterone in the research laboratory</p>

<p>H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.</p>

<p>Mesotocin is a peptide hormone that has a role in the regulation of water permeability and estradiol benzoate. It also regulates the physiological functions of the brain and has been shown to be involved in congestive heart failure, as it causes an increase in blood pressure. Mesotocin is found at high levels in human serum, but its activity is dependent on the presence of other hormones such as estradiol benzoate. The biological properties of mesotocin are largely unknown, although it is known to have receptor activity. The effects of this hormone on the kidney have been studied using mesotocin trifluroacetate (MTFA) and monoclonal antibody (mAb). MTFA causes an increase in glomerular filtration rate (GFR), which may be due to its ability to inhibit angiotensin II-induced vasoconstriction and decrease vascular resistance.</p>

<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>

<p>Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Amyloid beta-Protein (36-38) is a peptide that has molecular weight of 4.3 kDa. It is a fragment of amyloid precursor protein, which is cleaved by enzymes in the brain to create the peptide. Amyloid beta-Protein (36-38) has been found to be involved in Alzheimer's disease as it aggregates into β-sheet bundles and forms amyloid plaques in the brain. This protein can be detected using vibrational spectroscopy and has been observed to have a strain that changes depending on pH. This molecule also undergoes proteolysis by peptidases, which break down proteins into amino acids for analysis with an amino acid analyzer. The solute can be analyzed with an acid analysis or spectrometer, which are used to determine functional groups such as carboxylic acids, hydroxyls, or amides. Amyloid beta-Protein (36-38)</p>

<p>Catalogue peptide; min. 95% purity</p>