Bioquímicos e reagentes

<p>Inhibitor of p38 MAPK kinase</p>

<p>Neurokinin A is a peptide that is derived from the precursor protein, preprotachykinin A, and has been found to be an endogenous ligand for the NK-1 receptor. It is involved in a wide range of physiological processes such as neurotransmission and regulation of blood pressure. Neurokinin A has been shown to inhibit adenylate cyclase activity in guanethidine-sensitive tissues and ionophores-resistant cells. The effects of Neurokinin A are not due to its ability to bind to the NK-1 receptor but rather through other mechanisms. The amino acid sequence of this peptide was first determined by cloning methods in 1984 and it has since been used extensively as a tool for studying the function of this receptor. Neurokinin A also inhibits cell proliferation in glioma cells and has been shown to have an inhibitory effect on Ca2+ concentration during electrical nerve stimulation.</p>

<p>Mouse Plasminogen ELISA Kit</p>

<p>SEK1 antibody is a highly specialized product used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, offering researchers flexibility in their experiments. This antibody specifically targets glycopeptides, which are high polymers with glycosylation. It is commonly used for various applications, including the study of hormone peptides and intraocular processes.</p>

<p>Horse CRP ELISA Kit</p>

<p>Dog Red Blood Cells (DRBC) are biospecimens that can be used in various research applications in the life sciences and veterinary fields. These cells have been extensively studied and characterized for their molecular properties. DRBC have been used in molecular docking studies to investigate interactions with specific targets, such as 3T3-L1 preadipocytes or activated nuclear extracts. DRBC can also be used in assays to measure specific molecules or enzymes. For example, they have been used to study the effects of thiocyanate on human enzymes or to develop monoclonal antibodies against certain targets. Additionally, DRBC can be utilized in polymerase chain reaction (PCR) experiments for genetic analysis. In veterinary applications, DRBC have been employed to study the cation transport mechanisms or growth hormone receptor activation in dogs. They have also been used to measure creatine kinase levels, which can indicate muscle damage. Overall, Dog Red Blood Cells are valuable resources for researchers and veterinarians seeking to understand various biological</p>

<p>ELISA kit for the detection of Mouse Resistin in the research laboratory</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FMOD antibody, catalog no. 70R-5310</p>

<p>ELISA Kit for detection of IgA in the research laboratory</p>

<p>ELISA kit for the detection of Parietal Cell in the research laboratory</p>

<p>Biotin labeling kit for IgG</p>

<p>ELISA Kit for detection of PPARa in the research laboratory</p>

<p>ELISA Kit for detection of beta 2 Microglobulin in the research laboratory</p>

<p>Goat anti-rabbit IgG (H+L) (biotin) was raised in goat using rabbit IgG, whole molecule as the immunogen.</p>

<p>Adrenaline/Noradrenaline ELISA Kit for the rapid quantitative determination of Adrenaline/Noradrenaline in plasma</p>

<p>ELISA kit for detection of Serotonin in the research laboratory</p>

<p>Rabbit polyclonal virD2 antibody (HRP)</p>

<p>ELISA kit for the detection of Thyroglobulin in the research laboratory</p>

<p>Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.</p>

<p>Rabbit polyclonal PPP3R1 antibody</p>

<p>ELISA kit for the detection of Cathepsin G in the research laboratory</p>

<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>

<p>ELISA kit for the detection of Phospholipid Screen IgG/IgM in the research laboratory</p>

<p>Please enquire for more information about Human Fibrinogen ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dog Osteopontin ELISA Kit - OPN is confined to the distal parts of a subset of nephrons. In the kidney the expression of OPN is severely upregulated during renal injury.Â</p>

<p>Rat Myoglobin ELISA Kit</p>

<p>Human Apolipoprotein H ELISA Kit</p>

<p>Please enquire for more information about Rat Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Monkey Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Rat Transferrin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Highly sensitive Mouse Albumin ELISA kits are for the measurement of albumin in your samples. The kits are complete with ready to use reagents necessary to perform the assays.</p>

<p>Please enquire for more information about Dog IgG ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA Kit for detection of VEGF in the research laboratory</p>

<p>ELISA Kit for detection of IL17 in the research laboratory</p>

<p>ELISA kit for the detection of PR3  in the research laboratory</p>

<p>GRK5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>ELISA Kit for detection of Prolactin in the research laboratory</p>

<p>ELISA Kit for detection of MMP3 in the research laboratory</p>

<p>ELISA kit for the detection of IL1 beta in the research laboratory</p>

<p>ELISA kit for detection of CMV in the research laboratory</p>

<p>ELISA Kit for detection of PGF2a in the research laboratory</p>

<p>ELISA kit for the detection of Leptin Receptor in the research laboratory</p>

<p>ELISA Kit for detection of Prolactin in the research laboratory</p>

<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>

<p>ELISA kit for detection of Histamine in the research laboratory</p>

<p>ELISA kit for detection of Human IL4 in the research laboratory</p>

<p>GNRHR antibody was raised in Rabbit using Human GNRHR as the immunogen</p>

<p>BACE1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Please enquire for more information about 3,7,11,15,19,23,27,31,35-nonamethyl-2E,6E,10E,34-hexatriacontatetraene-1,15,19,23,27,31-hexol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>MOG(35-55) human corresponds to amino acids 35 to 55 of the human myelin oligodendrocyte glycoprotein (MOG). It can be used in multiple sclerosis research to induce experimental autoimmune encephalomyelitis (EAE) in mouse and rat models.</p>

<p>Please enquire for more information about Fumaric acid-d4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>CD152 antibody (PE) was raised in hamster using murine CD152/CTLA-4 as the immunogen.</p>

<p>The Glucagon (Human, Rat, Mouse)-EIA Kit is a competitive enzyme immunoassay for the quantitative measurement of human glucagon in urine. The kit provides a competitive binding assay format that is designed to measure the concentration of glucagon in urine samples and provides a quantitative result.</p>

<p>Troponin1 is a protein that is found in the muscle cells of humans. Troponin1 binds to actin, tropomyosin, and troponin C, which are proteins that make up the thin filament of the sarcomere. Tropomyosin blocks actin binding sites on the thin filament and prevents cross-bridge formation. When tropomyosin is displaced by troponins, it exposes these sites for interaction with myosin heads, which form cross-bridges with actin. Troponins also regulate calcium release from the sarcoplasmic reticulum during excitation-contraction coupling. The human troponins are encoded by different genes and are identified as TNN1 (Troponin 1), TNN2 (Troponin 2), TNN3 (Troponin 3), or TNN4 (Troponin 4). This antibody reacts with human cardiac and skeletal muscle tropomyosins and not</p>

<p>p-Perfluoroterphenyl is a potent inhibitor of kinases, which are enzymes that play a crucial role in the regulation of cell growth and division. This compound has been extensively studied in Chinese medicinal research for its anticancer properties. It has been shown to inhibit the growth of tumor cells and induce apoptosis, or programmed cell death, in cancer cells. Additionally, p-Perfluoroterphenyl has been found to be an effective inhibitor of protein kinases, which regulate many important cellular processes. This analog has also been detected in human urine samples, indicating its potential as a diagnostic tool for cancer detection and treatment. Overall, p-Perfluoroterphenyl is a promising new compound with potential applications in cancer therapy and diagnosis.</p>

<p>SNIPER(ABL)-058 is a cutting-edge selective protein degrader, developed from the field of chemical biology. It is based on a bifunctional small molecule that acts as a degrader by recruiting the ubiquitin-proteasome system to specifically tag the target protein for degradation. This compound is synthesized through precise chemical modifications designed to form specific interactions with its target, namely the BCR-ABL protein, a critical driver in certain cancer pathways.</p>

<p>Bisoprolol is a peptide that binds to the beta-adrenergic receptor and is used as a research tool to study the pharmacology of this receptor. Bisoprolol is a selective beta-1 receptor antagonist, which can inhibit the activation of this receptor. It has been shown to inhibit tumor growth in mice by inhibiting protein interactions with cell membranes, which decreases calcium levels in cells. The main mechanism of action for bisoprolol is through inhibition of protein interactions with cell membranes, which leads to decreased intracellular calcium levels and subsequent inhibition of cellular processes such as protein synthesis.</p>

<p>Rapalink-1 is a gene therapy drug that has been shown to be effective against resistant mutants of malignant brain tumors. Rapalink-1 is a protein that has been engineered to bind to mesenchymal markers and inhibit the progression of cancer cells. This protein also has the ability to induce autophagy, which can lead to axonal growth and help with ischemia–reperfusion injury in pediatric patients. Rapalink-1 inhibits tumor growth by triggering autophagy, which can lead to axonal growth and help with ischemia–reperfusion injury in pediatric patients. Rapalink-1 is an autophagy inducer that binds to mesenchymal markers on cancer cells and inhibits the progression of cancer cells. It also has the ability to induce autophagy, which can lead to axonal growth and help with ischemia–reperfusion injury in pediatric patients.</p>

<p>Decorsin is a research tool that is an activator and ligand for the human receptor. It binds to the receptor by altering its conformation, which leads to cell signaling. Decorsin has been shown to inhibit ion channels, such as potassium channels, and may also function as a receptor antagonist. Decorsin is a high-purity protein with a purity of &gt; 95%. This protein is used in cell biology, pharmacology, and life science research. It can be used as an inhibitor of peptides in the field of protein interactions.</p>

<p>PKCβpseudosubstrate is a peptide inhibitor, which is derived from the regulatory domain of protein kinase C beta (PKCβ). It functions by mimicking the substrate's binding sequence, thereby competitively inhibiting the kinase activity of PKCβ. As a pseudosubstrate, it binds to the catalytic domain of PKCβ, preventing the phosphorylation of actual substrates by occupying the active site.</p>

<p>ELISA kit for detection of EGF in the research laboratory</p>

<p>Tosedostat-d5 is an analog of Tosedostat, an anticancer drug that inhibits the activity of a variety of kinases involved in cancer cell growth and survival. This compound has been shown to induce apoptosis in human cancer cells and has demonstrated promising results in preclinical studies. Tosedostat-d5 is labeled with five deuterium atoms, which makes it useful as a tracer for pharmacokinetic and metabolic studies. It is also used as a tool for investigating the metabolism of other drugs, such as rifampicin and astaxanthin, in Chinese hamster ovary cells. Inhibitors of tosedostat-d5 have been developed for use in cancer therapy, making this compound an important tool for research into new anticancer treatments.</p>

<p>SR-4370 is a potent inhibitor of the histone deacetylase (HDAC) enzyme class. It has been shown to inhibit cholesterol synthesis and lipid biosynthesis in cells, as well as inhibiting cancer cell proliferation. SR-4370 also has antioxidant effects, which may be due to its ability to inhibit the activation of NF-κB and downstream mediators. In addition, this compound has been shown to have synergistic effects with other HDAC inhibitors and chemotherapy drugs. This drug is being developed for the treatment of cancers such as prostate cancer, melanoma, breast cancer, colon cancer, and head and neck cancer.</p>

<p>Hamster (CHO) Glutathione S Transferase Pi (GSTp) ELISA Kit<br>Glutathione S-transferase Pi (GSTp) is a metabolic enzyme that facilitates metabolite detoxification and antioxidation. GSTp reduces efficacy of chemotherapy drugs and inhibits tumor-cell apoptosis.</p>

<p>ELISA Kit for detection of MMP1 in the research laboratory</p>

<p>SARS-CoV-2 Spike RBD Antibody Pair 1</p>

<p>ELISA kit for the detection of GBM in the research laboratory</p>

<p>Adrenaline/Noradrenaline/Dopamine ELISA Kit for the rapid quantitative determination of Adrenaline/Noradrenaline/Dopamine in plasma</p>

<p>ELISA Kit for detection of Triiodothyronine in the research laboratory</p>

<p>ELISA Kit for detection of PDGFAB in the research laboratory</p>

<p>Thymus peptide C is a peptide that is an inhibitor of Protein interactions. It binds to the receptor and activates the Ligand, which then inhibits ion channels. Thymus peptide C has been used as a research tool to study the inhibition of ion channels in cells. This peptide has also been used as an antibody for the detection of antigens that are associated with cell proliferation.</p>

<p>The MEF2A antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and inhibits the activity of MEF2A, a transcription factor involved in various cellular processes. This polyclonal antibody is highly specific and can be used for a wide range of applications in research laboratories.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.</p>

<p>Mesotocin is a peptide hormone that has a role in the regulation of water permeability and estradiol benzoate. It also regulates the physiological functions of the brain and has been shown to be involved in congestive heart failure, as it causes an increase in blood pressure. Mesotocin is found at high levels in human serum, but its activity is dependent on the presence of other hormones such as estradiol benzoate. The biological properties of mesotocin are largely unknown, although it is known to have receptor activity. The effects of this hormone on the kidney have been studied using mesotocin trifluroacetate (MTFA) and monoclonal antibody (mAb). MTFA causes an increase in glomerular filtration rate (GFR), which may be due to its ability to inhibit angiotensin II-induced vasoconstriction and decrease vascular resistance.</p>

<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>

<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>

<p>Amyloid beta-Protein (36-38) is a peptide that has molecular weight of 4.3 kDa. It is a fragment of amyloid precursor protein, which is cleaved by enzymes in the brain to create the peptide. Amyloid beta-Protein (36-38) has been found to be involved in Alzheimer's disease as it aggregates into β-sheet bundles and forms amyloid plaques in the brain. This protein can be detected using vibrational spectroscopy and has been observed to have a strain that changes depending on pH. This molecule also undergoes proteolysis by peptidases, which break down proteins into amino acids for analysis with an amino acid analyzer. The solute can be analyzed with an acid analysis or spectrometer, which are used to determine functional groups such as carboxylic acids, hydroxyls, or amides. Amyloid beta-Protein (36-38)</p>

<p>Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.</p>

<p>Catalogue peptide; min. 95% purity</p>