Bioquímicos e reagentes

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DNAJC12 antibody, catalog no. 70R-3982</p>

<p>HA antibody was raised in rabbit using amino acid residues YPYDVPDYA conjugated to KLH as the immunogen.</p>

<p>Clocinizine HCL chemical reference substance</p>

<p>Rabbit polyclonal NCBP1 antibody</p>

<p>Rabbit polyclonal OLFM1 antibody</p>

<p>CYP11B2 protein is a vital component in the liver microsomes that plays a crucial role in various biological processes. This protein is involved in the synthesis of aldosterone, a hormone that regulates electrolyte and water balance in the body. CYP11B2 protein is also known to be associated with chemokines, antigens, and growth factors, making it an essential factor in Life Sciences research.</p>

<p>SEPHS1 antibody was raised using the C terminal of SEPHS1 corresponding to a region with amino acids PKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS</p>

<p>Purified Rabbit polyclonal PJCG2 antibody</p>

<p>Rabbit polyclonal CHRNB1 antibody</p>

<p>Region of LAG 1 protein corresponding to amino acids APMGSDPPTA CCFSYTARKL PRNFVVDYYE TSSLCSQPAV VFQTKRSKQV CADPSESWVQ EYVYDLELN.</p>

<p>The PR6 antibody is a highly specialized monoclonal antibody with unique characteristics. It has been extensively studied for its hybridization capabilities and its ability to bind to the amino-terminal region of specific proteins. This antibody exhibits high viscosity, making it ideal for use in assays that require increased sensitivity.</p>

<p>Rabbit polyclonal Annexin A5 antibody (HRP)</p>

<p>Hexestrol Conjugate for use in immunoassays</p>

<p>MSL3 antibody was raised in Rabbit using Human MSL3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PON1 antibody, catalog no. 70R-5362</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TNNI3K antibody, catalog no. 70R-4101</p>

<p>CSTF2 antibody was raised using the N terminal of CSTF2 corresponding to a region with amino acids VDPEIALKILHRQTNIPTLIAGNPQPVHGAGPGSGSNVSMNQQNPQAPQA</p>

<p>DBI antibody was raised in Rabbit using Human DBI as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CLU antibody, catalog no. 70R-10249</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>The ALDH2 antibody is a monoclonal antibody used in Life Sciences research. It has been shown to effectively neutralize ALDH2 activity, which is essential for the metabolism of ethanol and other aldehydes. This antibody can be used in various applications such as lysis and electrode-based assays to study the role of ALDH2 in different biological processes.</p>

<p>DDT antibody was raised in Rabbit using Human DDT as the immunogen</p>

<p>Purified recombinant E.coli NDK protein (His tag)</p>

<p>IKBKG antibody was raised in Rabbit using Human IKBKG as the immunogen</p>

<p>ERCC1 antibody was raised in Rabbit using Human ERCC1 as the immunogen</p>

<p>Purified Polyclonal CEBP beta antibody</p>

<p>Rabbit polyclonal ANKRD20A3 antibody</p>

<p>IL8RB antibody was raised in Rabbit using Human IL8RB as the immunogen</p>

<p>Cytochrome b245 Light Chain Monoclonal Antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CANT1 antibody, catalog no. 70R-5814</p>

<p>The nNOS antibody is a powerful tool used in life sciences research. It is a monoclonal antibody that specifically targets neuronal nitric oxide synthase (nNOS), an enzyme involved in the production of nitric oxide. This antibody can be used for various applications, including immunohistochemistry, western blotting, and flow cytometry.</p>

<p>FBXO2 antibody was raised in Rabbit using Human FBXO2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ELAVL4 antibody, catalog no. 70R-4836</p>

<p>Keratin K76 antibody was raised in Guinea Pig using synthetic peptide (C-LGGAGSISVSHSGM) of human keratin coupled to KLH as the immunogen.</p>

<p>COX4I2 antibody was raised in Rabbit using Human COX4I2 as the immunogen</p>

<p>Rabbit polyclonal TIMP2 antibody (FITC)</p>

<p>The ALDH1A2 antibody is a highly specialized product in the field of Life Sciences and Antibodies. It is specifically designed to target and interact with ALDH1A2, a growth factor that plays a crucial role in various biological processes. This antibody has been extensively tested and validated for its effectiveness in detecting and quantifying ALDH1A2 levels.</p>

<p>CDKL3 antibody was raised in Rabbit using Human CDKL3 as the immunogen</p>

<p>Rabbit polyclonal Catenin gamma antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CD22 antibody, catalog no. 70R-9913</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BTNL9 antibody, catalog no. 70R-7019</p>

<p>Endogl1 antibody was raised in rabbit using the N terminal of Endogl1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACSS2 antibody, catalog no. 70R-10248</p>

<p>Rabbit polyclonal ABHD14A antibody</p>

Rabbit polyclonal OVOL1 antibody

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACMSD antibody, catalog no. 70R-6311</p>

<p>EXOC6 antibody was raised using the middle region of EXOC6 corresponding to a region with amino acids YRCLHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFT</p>

<p>Region of CNTF protein corresponding to amino acids MAFTEHSPLT PHRRDLCSRS IWLARKLRSD LTALTESYVK HQGLNKNINL DSADGMPVAS TDQWSELTEA ERLQENLQAY RTFHVLLARL LEDQQVHFTP TEGDFHQAIH TLLLQVAAFA YQIEELMILL EYKIPRNEAD GMPINVGDGG LFEKKLWGLK VLQELSQWTV RSIHDLRFIS SHQTGIPARG SHYIANNKKM.</p>

<p>Purified recombinant Human STX2 Protein (His tag)</p>

<p>Rabbit Polyclonal Androgen Receptor antibody (Ser650)</p>

<p>COCH antibody was raised in Rabbit using Human COCH as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SIGLEC12 antibody, catalog no. 70R-6150</p>

<p>Affinity purified Rabbit polyclonal HIF2 alpha antibody</p>

<p>FSCN1 antibody was raised in Rabbit using Human FSCN1 as the immunogen</p>

<p>LOXL4 antibody was raised in rabbit using the middle region of LOXL4 as the immunogen</p>

<p>GPR35 antibody was raised in Rabbit using Human GPR35 as the immunogen</p>

<p>The SPARC antibody is a highly specialized nuclear antibody that is widely used in the field of Life Sciences. It specifically targets collagen and serves as an electrode for various research applications. Additionally, this antibody has neutralizing properties and can effectively bind to alpha-fetoprotein, making it a valuable tool in cancer research. The SPARC antibody is a monoclonal antibody that also exhibits anti-mesothelin activity and can be used as an antiviral agent. It is commonly employed in the development of inhibitors and therapeutic antibodies. This product is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. The SPARC antibody is activated upon interaction with human serum, allowing for precise detection and analysis of growth factors.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GRIP1 antibody, catalog no. 20R-1077</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HNF1A antibody, catalog no. 70R-9085</p>

<p>Affinity purified Rabbit polyclonal HSP70s antibody</p>

<p>PRTN3 antibody was raised in rabbit using the N terminal of PRTN3 as the immunogen</p>

<p>GFAP antibody was raised in rabbit using the C terminus of the 50 kDa human protein as the immunogen.</p>

<p>NGEF antibody was raised in Rabbit using Human NGEF as the immunogen</p>

<p>Rabbit polyclonal SmG antibody (biotin)</p>

<p>The AMH antibody is a highly potent and cytotoxic human protein that acts as a growth factor. It is capable of causing lysis and immobilization of target cells, making it an effective tool for research and diagnostic purposes. This antibody has been extensively studied for its neutralizing properties against insulin and insulin antibodies, making it a valuable asset in the field of diabetes research. Additionally, it has shown promising results in the detection and quantification of autoantibodies associated with various diseases. The AMH antibody also plays a crucial role in Life Sciences, particularly in the study of fibronectin, collagen, β-catenin, and other important cellular components. With both polyclonal and monoclonal variants available, this antibody offers versatility and reliability in scientific investigations.</p>

18-247 amino acids: MGSSHHHHHH SSGLVPRGSH MEDDVTTTEE LAPALVPPPK GTCAGWMAGI PGHPGHNGTP GRDGRDGTPG EKGEKGDAGL LGPKGETGDV GMTGAEGPRG FPGTPGRKGE PGEAAYVYRS AFSVGLETRV TVPNVPIRFT KIFYNQQNHY DGSTGKFYCN IPGLYYFSYH ITVYMKDVKV SLFKKDKAVL FTYDQYQEKN VDQASGSVLL HLEVGDQVWL QVYGDGDHNG LYADNVNDST FTGFLLYHDT N

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ASGR2 antibody, catalog no. 70R-2075</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SRGAP1 antibody, catalog no. 70R-9502</p>

<p>CCDC146 antibody was raised using the middle region of CCDC146 corresponding to a region with amino acids KEIEKEWLKVLRDEEMHALAIAEKSQEFLEADNRQLPNGVYTTAEQRPNA</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Nxph1 antibody, catalog no. 70R-9330</p>

<p>Rabbit Polyclonal HSF1 antibody (Ser303)</p>

<p>AKR1C3 antibody was raised in Rabbit using Human AKR1C3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HLTF antibody, catalog no. 70R-8247</p>

<p>The p53 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in the regulation of pluripotent cells and is activated in response to various cellular stresses. This inhibitory factor targets oncogenic kinases and promotes cell cycle arrest or apoptosis, depending on the severity of DNA damage. The p53 antibody is widely used for immunohistochemical detection and chromatin immunoprecipitation assays to study its binding activity and interactions with other proteins. Additionally, it has been found to have potential diagnostic value, as autoantibodies against p53 have been detected in certain cancers. Researchers rely on this powerful tool to investigate the intricate mechanisms involved in cellular responses and gain insights into cancer biology.</p>

<p>Rabbit polyclonal MRPL16 antibody</p>

<p>The Pleiotrophin antibody is a highly versatile and reactive chemokine that plays a crucial role in various biological processes. This antibody is available as both polyclonal and monoclonal forms, offering researchers flexibility in their experimental designs. It has been extensively studied in the field of Life Sciences due to its ability to neutralize the effects of Pleiotrophin, thereby modulating cellular functions.</p>

<p>Gliadin Antibody is a specific antibody that is used in various applications, particularly in the field of Life Sciences. It is commonly used for the detection and quantification of gliadin, a protein found in wheat and other gluten-containing grains. This antibody can be used in techniques such as hemolysis assays, reaction solutions, polymerase chain reactions (PCR), dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE), and more. The Gliadin Antibody is highly specific and recognizes gliadin with high affinity. It can be used to study the presence and distribution of gliadin in different samples, such as food products or biological samples. This antibody is often used in research related to celiac disease, gluten sensitivity, and other gluten-related disorders. Monoclonal antibodies are widely used in research and diagnostics due to their high specificity and reproducibility. The Gliadin Antibody is a monoclonal antibody, meaning it is</p>

<p>EPHA2 antibody was raised in Mouse using a purified recombinant fragment of EPHA2 expressed in E. coli as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PFKL antibody, catalog no. 70R-1248</p>

<p>The Desmin antibody is an important tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets Desmin, a protein involved in muscle cell structure and function. This antibody has been widely used in research to study the role of Desmin in various biological processes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RELB antibody, catalog no. 20R-1183</p>

<p>CORIN antibody was raised using the C terminal of CORIN corresponding to a region with amino acids HPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITG</p>

<p>Goat anti-cat IgG (biotin) was raised in goat using feline IgG F(c) fragment as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LPCAT1 antibody, catalog no. 70R-6633</p>

<p>RPRD1B antibody was raised using the middle region of RPRD1B corresponding to a region with amino acids KKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENAAS</p>

<p>Rabbit anti-cat IgG (H + L) (Alk Phos) was raised in rabbit using feline IgG whole molecule as the immunogen.</p>

<p>ESAM antibody was raised in Rabbit using Human ESAM as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PTPRR antibody, catalog no. 70R-6617</p>

<p>Rabbit polyclonal ARMC6 antibody</p>

<p>Affinity purified Rabbit polyclonal MRCK alpha antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PIGZ antibody, catalog no. 70R-7100</p>

<p>OSBPL1A antibody was raised using the middle region of OSBPL1A corresponding to a region with amino acids EGEHLGSRKHRMSEEKDCGGGDALSNGIKKHRTSLPSPMFSRNDFSIWSI</p>

<p>The Involucrin antibody is a highly specialized monoclonal antibody that targets the biomolecule involucrin. It is commonly used in Life Sciences research to study the role of involucrin in various biological processes. Involucrin is a glycoprotein that plays a crucial role in the formation and maintenance of the skin barrier. This antibody specifically binds to involucrin, allowing researchers to study its function and localization within cells.</p>

<p>LYPD5 antibody was raised using the N terminal of LYPD5 corresponding to a region with amino acids WTGPPAGQTQSNADALPPDYSVVRGCTTDKCNAHLMTHDALPNLSQAPDP</p>

<p>ACTL7B antibody was raised in Rabbit using Human ACTL7B as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EDEM1 antibody, catalog no. 70R-6871</p>

<p>Capsl antibody was raised in rabbit using the C terminal of Capsl as the immunogen</p>

<p>The RARG antibody is a monoclonal antibody that targets the retinoic acid receptor gamma (RARG). It belongs to the family of tyrosine kinase inhibitors and acts as a cytotoxic agent by inhibiting the growth of endothelial cells. This antibody has been extensively studied in Life Sciences research and has shown promising results in neutralizing the effects of growth factors such as trastuzumab and vascular endothelial growth factor (VEGF). Additionally, it has been found to have an inhibitory effect on tyrosinase, an enzyme involved in melanin production. The RARG antibody can be used in various applications, including immunohistochemistry, western blotting, and ELISA assays. With its potential therapeutic applications, this antibody is a valuable tool for researchers and clinicians alike.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its potency has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BAT5 antibody, catalog no. 70R-6310</p>