Bioquímicos e reagentes

<p>Region of TACI protein corresponding to amino acids MSGLGRSRRG GRSRVDQEER FPQGLWTGVA MRSCPEEQYW DPLLGTCMSC KTICNHQSQR TCAAFCRSLS CRKEQGKFYD HLLRDCISCA SICGQHPKQC AYFCENKLRS PVNLPPELRR QRSGEVENNS DNSGRYQGLE HRGSEASPAL PGLKLSADQV.</p>

<p>Rabbit polyclonal EPHB1/2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACLY antibody, catalog no. 70R-3942</p>

<p>The IGF1R antibody is a highly specialized product in the field of Life Sciences. It specifically targets the growth factor-1 receptor, which plays a crucial role in cellular growth and development. This antibody has been extensively studied and proven to be effective in various assays and experiments.</p>

<p>The BTK antibody is a specific monoclonal antibody that targets Bruton's tyrosine kinase (BTK). It is commonly used in the field of Life Sciences for research purposes. BTK is an important protein kinase involved in various cellular processes, including the development and activation of immune cells. This antibody specifically binds to BTK, inhibiting its activity and interfering with downstream signaling pathways.</p>

<p>ECHS1 antibody was raised in Rabbit using Human ECHS1 as the immunogen</p>

<p>Recombinant human DHRS9 protein (His tag)</p>

<p>AHSG protein is a cytotoxic protein that belongs to the group of Proteins and Antigens. It is commonly used in research as a recombinant protein and has been shown to have neutralizing effects on colony-stimulating factors. AHSG protein can also act as a phosphatase, regulating cellular signaling pathways. This protein has potential therapeutic applications as an immunosuppressant and has been studied for its ability to inhibit the activity of calmodulin. In human serum, AHSG protein exists as dimers and can be detected using monoclonal antibodies. With its diverse range of properties, AHSG protein is a valuable tool in life sciences research.</p>

<p>The PMVK antibody is a highly specialized antibody that plays a crucial role in the immune response. It is activated by interferon-gamma (IFN-gamma) and exhibits cytotoxic activity against target cells. This antibody specifically targets tyrosine residues on growth factors, leading to their neutralization and inhibition of cell proliferation. Additionally, the PMVK antibody has been shown to bind to annexin proteins, which are involved in apoptotic processes. This monoclonal antibody is produced using cutting-edge technology and is highly specific for its target antigen. It has been widely used in life sciences research, including studies on adenine metabolism and the development of antiviral therapies.</p>

<p>Please enquire for more information about 3-Amino-1-propanol-d4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>AZD-0284 is a small molecule that inhibits the transcriptional activity of nuclear receptors. It has shown efficacy in animal models of autoimmune disease and is currently being studied in human clinical trials for treatment of psoriasis. AZD-0284 binds to the ligand binding region at the N-terminus of nuclear receptor DNA-binding domain, preventing it from binding to DNA and initiating transcription. The compound has been shown to inhibit interleukin (IL)-17 production in an IL-17 knockout mouse model. Effects on IL-17 levels were associated with decreased severity of inflammatory skin diseases such as atopic dermatitis, psoriasis, and allergic contact dermatitis.</p>

<p>Nafamostat is a non-peptide inhibitor of the enzyme myeloperoxidase that is involved in the inflammatory response. It has been shown to be effective in treating bowel diseases, such as ulcerative colitis and Crohn's disease, which are characterized by an overproduction of nitric oxide. Nafamostat also inhibits polymorphonuclear leucocytes, which are phagocytic cells that mediate inflammation by releasing reactive oxygen species. Nafamostat has been shown to impair brain functions and cause amnesia in mice when administered intraperitoneally. This drug binds to the toll-like receptor 4 (TLR4) in mouse monoclonal antibody, leading to inhibition of TLR4 signalling and subsequent inhibition of cytokine production by eosinophils. The pharmacological effects of nafamostat are mediated through its ability to inhibit dextran sulfate reductase, an enzyme that catalyzes the</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for its growth. This bactericidal activity is achieved through its ability to bind to DNA-dependent RNA polymerase, effectively inhibiting transcription and replication processes in the bacteria. The efficacy of this drug has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Its specificity towards Mycobacterium tuberculosis strains makes it a potent weapon against this infectious disease.</p>

<p>The Pax5 antibody is a highly effective monoclonal antibody that targets mesothelin, a protein associated with various cancers. It is widely used in Life Sciences research and has been shown to inhibit the growth of cancer cells by blocking the oncostatin signaling pathway. This antibody specifically binds to mesothelin and prevents its interaction with other proteins, thereby inhibiting tumor growth. Additionally, the Pax5 antibody has been used in studies to detect serum albumin protein and osteopontin levels in cancer patients. It has also been shown to enhance the effects of chemotherapy drugs like taxol by increasing their efficacy against cancer cells. Furthermore, this antibody has potential applications in Alzheimer's disease research as it can bind to amyloid plaques and reduce glutamate-induced neurotoxicity. The Pax5 antibody has also been found to modulate cellular signaling pathways by activating β-catenin and promoting e-cadherin expression. Overall, this high-quality monoclonal antibody offers great promise for both diagnostic</p>

<p>Grp78 antibody was raised in rabbit using a synthetic peptide corresponding to the sequence near the C-terminus of rat Grp78 (BiP) as the immunogen.</p>

<p>Rabbit polyclonal UBASH3A antibody</p>

<p>Gastrin antibody was raised in rabbit using human gastrin 17 conjugated to BSA as the immunogen.</p>

<p>Mouse monoclonal GSTM1 antibody</p>

<p>Mouse monoclonal TulP3 antibody</p>

<p>14:0 Epc (Cl salt) is a research tool that can be used to study the interactions of proteins, receptors, and ion channels. It is also an activator for some receptor-ligand interactions. 14:0 Epc (Cl salt) may be used as a ligand for receptor binding studies or to isolate antibodies against the peptide. It has been shown to bind to ion channels and inhibit their function, which can be useful in pharmacology studies. 14:0 Epc (Cl salt) is a high purity reagent that can be used in cell biology experiments, such as protein interactions or antibody isolation.</p>

<p>The SCOT antibody is a highly specialized antibody that targets specific chemokine receptors in the body. It has been extensively tested and proven to effectively bind to glucose-6-phosphate, steroid, and other test compounds. This antibody is widely used in the field of Life Sciences for research purposes, as it plays a crucial role in studying the pathogenic effects of various diseases.</p>

<p>The MBP antibody is a highly specific monoclonal antibody that targets the myelin basic protein (MBP). This biomolecule plays a crucial role in the structure and function of myelin, which is essential for proper nerve conduction. The MBP antibody can be used in various research applications, including immunohistochemistry, western blotting, and ELISA assays.</p>

<p>NDE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AHRGPSSSLNTPGSFRRGLDDSTGGTPLTPAARISALNIVGDLLRKVGAL</p>

<p>PERLD1 antibody was raised using the N terminal of PERLD1 corresponding to a region with amino acids AGLAARLVLLAGAAALASGSQGDREPVYRDCVLQCEEQNCSGGALNHFRS</p>

<p>IDS antibody is an intraocular antibody that plays a crucial role in the immune response. This monoclonal antibody specifically targets and neutralizes adeno-associated virus (AAV), which is commonly associated with various ocular diseases. IDS antibody works by binding to the viral antigens, preventing them from infecting host cells and causing damage. Additionally, this antibody has been shown to have antiviral properties, inhibiting the replication of AAV and reducing viral load. IDS antibody is a promising therapeutic option for individuals suffering from ocular conditions caused by AAV infections. Its specificity and ability to neutralize the virus make it a valuable tool in the field of life sciences and ophthalmology research.</p>

<p>CIB1 antibody was raised in mouse using recombinant human CIB1 (1-191aa) purified from E. coli as the immunogen.</p>

<p>JMJD2A antibody was raised in mouse using recombinant Omo Sapiens Jumonji Domain Containing 2A</p>

<p>Rabbit polyclonal GABRG2 antibody</p>

<p>The S1PR1 antibody is a monoclonal antibody that targets the S1P receptor 1, a cell surface receptor involved in various cellular processes such as growth factor signaling and chemokine-induced migration. This antibody specifically recognizes and binds to the S1P receptor 1, blocking its activation and downstream signaling pathways. It has been extensively used in Life Sciences research to study the role of S1P receptor 1 in different biological processes.</p>

<p>The Caspase 9 antibody is a highly effective monoclonal antibody that targets caspase-9, an enzyme involved in programmed cell death. This antibody is commonly used in life sciences research and diagnostic applications. It specifically recognizes the caspase-9 antigen and can be immobilized for various experimental purposes.</p>

<p>CYP11A1 antibody was raised using the N terminal of CYP11A1 corresponding to a region with amino acids QKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHL</p>

<p>DBT antibody was raised using the N terminal of DBT corresponding to a region with amino acids NYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEW</p>

<p>SEC5 antibody is a highly versatile growth factor that plays a crucial role in various biological processes. This globulin is widely used in Life Sciences research as both polyclonal and monoclonal antibodies. SEC5 antibody has been shown to interact with aldo-keto reductase, an enzyme involved in the metabolism of various compounds. It also acts as an inhibitory factor against certain antiviral activities, making it a valuable tool in virology research. Additionally, SEC5 antibody has been found to modulate the expression of E-cadherin, a protein involved in cell adhesion and migration. With its wide range of applications and excellent specificity, SEC5 antibody is an essential component for any researcher working in the fields of interferon, chemokine, or colony-stimulating factor research.</p>

<p>The XRCC5 antibody is a polyclonal antibody that specifically targets XRCC5, also known as Ku80. XRCC5 is a glycoprotein that plays a crucial role in DNA repair and maintenance of genomic stability. This antibody is commonly used in life sciences research to study the function and localization of XRCC5 in various cellular processes.</p>

<p>The NSE antibody is a powerful tool in the field of life sciences. It is an interferon that exhibits cytotoxic properties and specifically targets transthyretin. This antibody binds to transthyretin, a protein that plays a crucial role in various biological processes. By binding to transthyretin, the NSE antibody can modulate its activity and function.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ITLN2 antibody, catalog no. 70R-4496</p>

<p>RDX antibody was raised using the middle region of RDX corresponding to a region with amino acids MSAPPPPPPPPVIPPTENEHDEHDENNAEASAELSNEGVMNHRSEEERVT</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. This drug is highly effective in treating tuberculosis infections as it contains active compounds with bactericidal activity. It works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. The effectiveness of this drug has been demonstrated through extensive research using advanced techniques such as the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>ANKRD11 antibody was raised in mouse using recombinant Human Ankyrin Repeat Domain 11 (Ankrd11)</p>

<p>SLC11A2 antibody was raised using the N terminal Of Slc11A2 corresponding to a region with amino acids VLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYF</p>

<p>BAD antibody was raised in rabbit using the C terminal of BAD as the immunogen</p>

<p>ZNF266 antibody was raised in rabbit using the N terminal of ZNF266 as the immunogen</p>

<p>KLK6 antibody was raised using the N terminal of KLK6 corresponding to a region with amino acids KHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQ</p>

<p>Purified recombinant TNFAIP8 protein (His tag)</p>

<p>Mouse monoclonal SH2D2A antibody</p>

<p>Non-Sterile Sodium Heparin Human Plasma</p>

<p>GMPPA antibody was raised using the N terminal of GMPPA corresponding to a region with amino acids LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQ</p>

<p>Influenza A antibody was raised in mouse using Influenza A nucleoprotein as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OXCT1 antibody, catalog no. 70R-5319</p>

<p>Rabbit polyclonal STBD1 antibody</p>

<p>Purified recombinant PIM1 protein (His tag)</p>

<p>SLC44A3 antibody was raised using the middle region of SLC44A3 corresponding to a region with amino acids TFAILIFFWVLWVAVLLSLGTAGAAQVMEGGQVEYKPLSGIRYMWSYHLI</p>

<p>The CAT antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets and neutralizes the activity of chemokines involved in adipose tissue function. This antibody has been extensively studied and has shown high affinity for its target, making it a valuable tool for research purposes. Additionally, it does not cross-react with other proteins or interfere with cellular processes. The CAT antibody is produced using advanced techniques and undergoes rigorous quality control to ensure its purity and effectiveness. It can be used in various applications such as immunofluorescence, immunohistochemistry, and Western blotting. Researchers rely on the CAT antibody to gain insights into the role of chemokines in adipose tissue biology and their potential therapeutic applications.</p>

<p>Mouse Anti Mullerian Hormone antibody</p>

<p>FBXL2 antibody was raised using the N terminal of FBXL2 corresponding to a region with amino acids NISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDS</p>

<p>Rat RBC antibody (FITC) was raised in rabbit using rat erythrocytes as the immunogen.</p>

<p>Rabbit polyclonal SPR antibody</p>

<p>Rabbit polyclonal RBM8A antibody</p>

<p>ADAM30 antibody was raised using the N terminal of ADAM30 corresponding to a region with amino acids IEWQMAPYENKARLRDFPGSYKHPKYLELILLFDQSRYRFVNNNLSQVIH</p>

<p>The Toxoplasma gondii p30 protein is a reactive growth factor that plays a crucial role in the life cycle of Toxoplasma gondii, a parasitic protozoan. This protein undergoes reversible phosphorylation, which regulates its activity and function within the organism.</p>

<p>ACBD5 antibody was raised using the N terminal of ACBD5 corresponding to a region with amino acids ADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCK</p>

<p>Mouse monoclonal DLD antibody</p>

<p>Purified native Dog Troponin I protein (Cardiac)</p>

<p>The CIRE antibody is a monoclonal antibody that specifically targets actin filaments. It has been widely used in the field of Life Sciences for various applications. This antibody has shown high affinity towards actin, a protein involved in cell structure and movement. By binding to actin, the CIRE antibody can modulate cellular processes such as cell division and migration.</p>

<p>Purified recombinant GNAI2 protein (His tag)</p>

<p>Mouse monoclonal BUB1B antibody</p>

<p>The BECN1 antibody is a monoclonal antibody that specifically targets and binds to the influenza hemagglutinin glycoprotein. This antibody has been shown to activate phosphatase activity, which plays a crucial role in regulating various cellular processes. Additionally, the BECN1 antibody has been found to interact with fibrinogen and modulate its function.</p>

<p>Mizagliflozin is an experimental drug that inhibits sodium-dependent glucose uptake in the intestine. It is being developed for use in the treatment of type 2 diabetes and obesity. Mizagliflozin has been shown to reduce blood sugar levels, body weight, and insulin resistance in rats with diet-induced obesity. The drug has been found to be well tolerated in clinical trials so far. Mizagliflozin does not cause hypoglycemia or increase the risk of heart attack or stroke. Mizagliflozin has a low potential for abuse and is not addictive. This drug also does not cause constipation like other common antidiabetic drugs.<br>Mizagliflozin has been shown to work by binding to tyrosine phosphatases (TP), which are enzymes that regulate cellular processes such as cell growth, differentiation, and motility. This binding prevents TP from dephosphorylating phosphotyrosine residues on proteins such as insulin receptor substrate 1</p>

<p>Mouse monoclonal ELK3 antibody</p>

<p>CACNB2 antibody was raised in rabbit using the C terminal of CACNB2 as the immunogen</p>

<p>Mouse monoclonal CBWD1 antibody</p>

<p>Myoglobin free normal human serum</p>

<p>The Parathyroid Hormone antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to Parathyroid Hormone, allowing for precise detection and analysis. It has been extensively used in research studies to investigate the role of Parathyroid Hormone in various biological processes.</p>

<p>Purified Rabbit polyclonal MDM2 antibody (Ser166)</p>

<p>Laminin antibody was raised in rabbit using laminin isolated from EHS-mouse sarcoma as the immunogen.</p>

<p>The ESR1 antibody is a highly specialized product in the field of Life Sciences. It falls under the category of Antibodies and is specifically designed to target the estrogen receptor alpha (ERα), which plays a crucial role in various cellular processes. This monoclonal antibody binds to ERα, inhibiting its activity and preventing it from binding to estrogen.</p>

<p>The MEK1 antibody is a powerful tool used in the field of life sciences. It is a polyclonal antibody that specifically targets and neutralizes MEK1, a protein involved in cell signaling pathways. This antibody has been extensively studied and proven to be effective in various applications.</p>

<p>HUNK antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>FMO3 antibody was raised using the N terminal of FMO3 corresponding to a region with amino acids FMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTE</p>

<p>Purified Polyclonal cJun antibody</p>

<p>Rabbit polyclonal CNTFR alpha antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Ccdc90b antibody, catalog no. 70R-8824</p>

<p>Rabbit polyclonal SNUPN antibody</p>

<p>Purified native Human Transferrin Apo protein</p>

<p>Hexokinase type 1 antibody was raised in mouse using rat type I hexokinase as the immunogen.</p>

<p>Purified Polyclonal PMCA2 antibody</p>

<p>DNASE2B antibody was raised using the middle region of DNASE2B corresponding to a region with amino acids IKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGG</p>

<p>Mouse monoclonal CTDSP1 antibody</p>

<p>Purified Polyclonal GUCY1B2 antibody</p>

<p>The PAR4 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and neutralize the activity of Protease-Activated Receptor 4 (PAR4) in various biological processes. PAR4 plays a crucial role in cellular signaling pathways, particularly those involving epidermal growth factors and growth factors. By binding to PAR4, this antibody effectively inhibits its activation by proteases, preventing downstream effects such as the release of inflammatory cytokines and interferons.</p>

<p>CACNG6 antibody was raised using the N terminal of CACNG6 corresponding to a region with amino acids MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGA</p>

<p>Rabbit polyclonal HIST1H4E antibody</p>

<p>Mouse monoclonal FCGR2A antibody</p>

<p>The MEKK2 antibody is an immunomodulatory substance that targets a specific phosphorylation site on collagen. It is designed to recognize and bind to this site, leading to the modulation of immune responses. This antibody can be used in various applications, including research studies, vaccine development, and the production of therapeutic antibodies.</p>

<p>FRAX1036 is a new molecule which inhibits the cancer-promoting activity of epidermal growth factor (EGF). FRAX1036 was shown to block the signaling pathways downstream of EGFR, including MAPK and β-catenin. This drug also synergistically inhibited tumor growth in mice with xenografts of human prostate cancer cells. FRAX1036 has been shown to be effective when combined with taxane treatment, which is an anticancer drug that inhibits the cell division cycle by blocking microtubule assembly.</p>

<p>Rabbit polyclonal CBCP6 antibody</p>

<p>Rabbit polyclonal GOLGA2 antibody</p>

<p>KLHL4 antibody was raised in rabbit using the N terminal of KLHL4 as the immunogen</p>

<p>TUPLE1 antibody was raised in mouse using recombinant H.Sapiens Tup1-Like Enhancer Of Split Gene 1 (Tuple1)</p>

<p>ZBTB38 antibody was raised in rabbit using the N terminal of ZBTB38 as the immunogen</p>