Bioquímicos e reagentes

<p>Purified recombinant Human ACYP1 protein</p>

<p>Akt, also known as Protein Kinase B (PKB), is a critical signaling protein in cells that regulates essential processes like cell growth, survival, metabolism, and proliferation. It functions within the PI3K/Akt pathway, one of the primary pathways for cell survival and growth, which is activated by growth factors and hormones such as insulin. Upon activation, Akt is recruited to the cell membrane, where it is phosphorylated by kinases like PDK1, triggering its full activation. This allows Akt to influence downstream processes, promoting cell survival by inhibiting apoptosis, supporting cell growth via pathways like mTOR, and enhancing glucose metabolism—especially important for insulin response.Akt plays a significant role in diseases like cancer and diabetes. Dysregulation of the Akt pathway is frequently observed in cancer, often due to mutations in pathway components such as PI3K, PTEN, or Akt itself, resulting in increased cell survival, growth, and resistance to therapies. In diabetes, insulin resistance diminishes Akt pathway responsiveness, reducing glucose uptake and leading to elevated blood glucose levels. Thus, the Akt pathway is a focal point in therapeutic research, particularly for diseases where its regulatory effects on cell growth and metabolism are implicated.</p>

<p>C6ORF154 antibody was raised using the middle region of C6Orf154 corresponding to a region with amino acids NLDYNPLGDHVAGMLAVAVASSRTLEVLDLEGTGLTNQSAQTLLDMVENY</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. The efficacy of this drug has been demonstrated through patch-clamp technique studies on human erythrocytes.</p>

<p>GM2A antibody was raised using the N terminal of GM2A corresponding to a region with amino acids MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRS</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RHO antibody, catalog no. 70R-9928</p>

<p>BANP antibody was raised in Rabbit using Human BANP as the immunogen</p>

<p>Purified Polyclonal CEP70 antibody</p>

<p>PLA2G4B antibody was raised in rabbit using the N terminal of PLA2G4B as the immunogen</p>

<p>Mouse monoclonal MAP2K4 antibody</p>

<p>Rabbit polyclonal CD25 antibody (Ser268)</p>

<p>Fibulin 5 antibody was raised in Mouse using a purified recombinant fragment of Fibulin 5 expressed in E. coli as the immunogen.</p>

<p>MTA3 antibody was raised in mouse using recombinant Human Metastasis Associated 1 Family, Member 3</p>

<p>The CHK1 antibody is a highly specific polyclonal antibody that targets the human protein CHK1. It is commonly used in research and diagnostic applications to detect and quantify levels of CHK1 in various biological samples, including human hepatocytes. This antibody has been extensively validated and is known for its high sensitivity and specificity.</p>

<p>Purified recombinant MOB3B protein (His tag)</p>

<p>TXNDC5 antibody was raised using the N terminal of TXNDC5 corresponding to a region with amino acids ARAQEAAAAAADGPPAADGEDGQDPHSKHLYTADMFTHGIQSAAHFVMFF</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth by preventing transcription and replication. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>The Estrogen Receptor alpha antibody is a monoclonal antibody that targets the estrogen receptor alpha protein. This antibody is widely used in Life Sciences research to study the role of estrogen receptors in various biological processes. It specifically binds to the antigen binding domain of the estrogen receptor alpha, inhibiting its activity and preventing downstream signaling pathways.</p>

<p>Rabbit polyclonal CHST10 antibody</p>

<p>MTUS1 antibody was raised in Rabbit using Human MTUS1 as the immunogen</p>

<p>Purified recombinant Human UROD protein</p>

<p>Sequestosome 1 antibody was raised using the middle region of SQSTM1 corresponding to a region with amino acids EEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQE</p>

<p>The Influenza A Hemagglutinin protein is a key component in the field of Life Sciences. It plays a crucial role in the activation and regulation of various biological processes. This protein has been extensively studied for its potential therapeutic applications.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied and proven to be active using advanced techniques like the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.</p>

<p>PAIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSDGFDRAPEQTRPLRAPPSSQDKIPQQNSESAMAKPQVVVAPVLMSKLS</p>

<p>CPS1 antibody was raised in Rabbit using Human CPS1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TIMP2 antibody, catalog no. 70R-9696</p>

<p>Rabbit polyclonal TIMP4 antibody</p>

<p>The SIRPA antibody is a highly specialized monoclonal antibody that targets neurotrophic factors. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. This antibody is designed to specifically bind to SIRPA (signal regulatory protein alpha), a cell surface receptor that plays a crucial role in regulating immune responses.</p>

<p>ACCN3 antibody was raised using the N terminal of ACCN3 corresponding to a region with amino acids VATFLYQVAERVRYYREFHHQTALDERESHRLIFPAVTLCNINPLRRSRL</p>

<p>The PTGER3 antibody is a highly specific antibody that targets the PTGER3 protein. This protein is involved in various biological processes, including the regulation of cell growth and the immune response. The PTGER3 antibody can be used in a wide range of applications, including immunohistochemistry, Western blotting, and flow cytometry. It has been extensively validated for its specificity and sensitivity, making it a reliable tool for researchers in the field of life sciences. Whether you are studying helicobacter infection or investigating the role of growth factors in disease progression, the PTGER3 antibody will provide you with accurate and reproducible results. With its high affinity and low background staining, this monoclonal antibody is an essential tool for any researcher working in this area. Trust the PTGER3 antibody to deliver reliable and consistent results for your experiments.</p>

<p>Rabbit polyclonal MUNC18a antibody</p>

<p>The CELSR1 antibody is a highly specialized and potent neutralizing agent that targets the alpha-fetoprotein chemokine. This antibody has been extensively tested and proven effective in human serum, specifically targeting endothelial growth factors. It is commonly used in Life Sciences research for its ability to inhibit connexin activity. The CELSR1 antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. With its high affinity and specificity, this antibody ensures accurate and reliable results in experiments involving angptl3, adipose growth factors, and other related glycoproteins. Its versatility and efficacy make it an essential tool for any researcher in the field of Life Sciences.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IFNA5 antibody, catalog no. 70R-5360</p>

<p>Rabbit polyclonal PTGS2 antibody</p>

<p>CACNB3 antibody was raised using the N terminal of CACNB3 corresponding to a region with amino acids MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQ</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SETD7 antibody, catalog no. 70R-1046</p>

<p>The GAD65 antibody is a reactive growth factor that plays a crucial role in various biological processes. It is commonly used in Life Sciences research and diagnostics. This antibody specifically targets glutamate decarboxylase 65 (GAD65), an enzyme involved in the synthesis of the neurotransmitter gamma-aminobutyric acid (GABA). By binding to GAD65, this antibody can help researchers study GABAergic signaling pathways and investigate conditions such as epilepsy, Parkinson's disease, and autoimmune disorders.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANXA10 antibody, catalog no. 70R-6037</p>

<p>PTPN12 antibody was raised using the middle region of PTPN12 corresponding to a region with amino acids SSIEPEKQDSPPPKPPRTRSCLVEGDAKEEILQPPEPHPVPPILTPSPPS</p>

<p>Purified Polyclonal NDUFA4 antibody</p>

<p>Rabbit polyclonal KPB1/2 antibody</p>

<p>DRAM antibody was raised in rabbit using the N terminal of DRAM as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DYNC1I2 antibody, catalog no. 70R-4497</p>

<p>The GCG antibody is a monoclonal antibody that specifically targets the CD20 protein, a glycoprotein found on the surface of certain cells. This antibody-drug complex is designed to bind to the CD20 antigen, leading to the inhibition of cell growth and proliferation. The GCG antibody has shown promising results in the treatment of various diseases, including certain types of cancer and autoimmune disorders. It works by selectively targeting and destroying CD20-positive cells while sparing healthy cells. In addition to its therapeutic applications, this monoclonal antibody can also be used as a research tool for studying the role of CD20 in various biological processes. Its high specificity and affinity make it an invaluable tool for scientists and researchers working in the field of immunology.</p>

<p>Purified recombinant FCER1A protein (His tag)</p>

<p>KIAA0892 antibody was raised using the middle region of KIAA0892 corresponding to a region with amino acids MHQNFSQQLLQDHIEACSLPEHNLITWTDGPPPVQFQAQNGPNTSLASLL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KPTN antibody, catalog no. 70R-3023</p>

<p>Rabbit polyclonal PPFIA3 antibody</p>

<p>The WIF1 protein is a monoclonal antibody that belongs to the group of conjugated proteins. It has been shown to neutralize oncostatin, a growth hormone receptor inhibitory factor. This monoclonal antibody can specifically bind to autoantibodies and activate an antigen-antibody reaction. The WIF1 protein exhibits excellent photostability and can be used in various applications due to its emission properties. Its unique composition includes thiocyanate, which enhances its stability and efficacy.</p>

<p>FZD10 antibody was raised using a synthetic peptide corresponding to a region with amino acids PIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRF</p>

<p>SUZ12 antibody was raised in rabbit using the C terminal of SUZ12 as the immunogen</p>

<p>Purified Polyclonal ZNF280A antibody</p>

<p>TCF23 antibody was raised in rabbit using the C terminal of TCF23 as the immunogen</p>

<p>The AQP1 antibody is a highly specialized monoclonal antibody that targets the aquaporin 1 protein. Aquaporin 1 is a transmembrane protein that facilitates the transport of water across cell membranes. This antibody has been extensively studied and shown to have a high affinity for aquaporin 1, making it an excellent tool for research in various fields such as life sciences.</p>

<p>FMNL2 antibody was raised in Rabbit using Human FMNL2 as the immunogen</p>

<p>The FKBP52 antibody is a highly specialized monoclonal antibody that has the ability to neutralize the effects of angptl3, a growth factor involved in adipose tissue regulation. This antibody can be used in various life sciences applications, such as research and diagnostics. It specifically targets FK506-binding protein 52 (FKBP52), which plays a crucial role in modulating protein phosphatase activity. The FKBP52 antibody can effectively inhibit the interaction between FKBP52 and its target proteins, thereby preventing downstream signaling events. It has been extensively tested and validated for use in various experimental settings, including Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays. With its high specificity and affinity for FKBP52, this antibody is an essential tool for researchers studying the complex mechanisms underlying cellular processes related to adipose tissue regulation and growth factor signaling pathways.</p>

<p>Rabbit polyclonal RAD51L3 antibody</p>

<p>The NNMT antibody is a highly specialized monoclonal antibody that targets the N-methylation of nicotinamide, an important metabolic process. This antibody specifically recognizes and binds to Nicotinamide N-Methyltransferase (NNMT), an enzyme involved in the regulation of various biological processes.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections and contains active compounds that exhibit strong bactericidal activity. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, which prevents transcription and replication. The effectiveness of this drug has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes.</p>

<p>Rabbit polyclonal PPP2R2B antibody</p>

<p>Mouse monoclonal HIF1A antibody</p>

<p>CNNM3 antibody was raised in Rabbit using Human CNNM3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KHDRBS1 antibody, catalog no. 70R-5677</p>

<p>The HKR2 antibody is a specific antibody that has been widely used in Life Sciences research. It is a monoclonal antibody that specifically recognizes and binds to the HKR2 protein, which is involved in various cellular processes. This antibody can be used in different applications such as laser ablation, flow assays, and chemiluminescent immunoassays.</p>

<p>CISD2 antibody was raised in Rabbit using Human CISD2 as the immunogen</p>

<p>JMJD2B antibody was raised using the middle region of JMJD2B corresponding to a region with amino acids SASRASLKAKLLRRSHRKRSQPKKPKPEDPKFPGEGTAGAALLEEAGGSV</p>

<p>The IL32 antibody is a polyclonal antibody that is commonly used in the field of life sciences. It is specifically designed to target and neutralize IL32, an important protein involved in various biological processes. This antibody can be used for research purposes, such as studying the role of IL32 in disease development or evaluating its therapeutic potential.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Tigd4 antibody, catalog no. 70R-9206</p>

<p>GLRX2 antibody was raised in rabbit using the middle region of GLRX2 as the immunogen</p>

<p>CYB561 antibody was raised using the middle region of CYB561 corresponding to a region with amino acids NVLGLLLACFGGAVLYILTRADWKRPSQAEEQALSMDFKTLTEGDSPGSQ</p>

<p>TMEM16K antibody was raised using the C terminal of TMEM16K corresponding to a region with amino acids LKADIDATLYEQVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAA</p>

<p>The Troponin complex contains three subunits, I, T and C, of approximately 100 kDa each. Cardiac specific Troponin I and Troponin T have been shown as better indicators of Myocardial Infarction than CK-MB. In conjunction with ECG, Troponin measurement has a very high diagnostic efficiency. Extract grade Troponin is an excellent source for controls.</p>

<p>Rabbit Polyclonal cJun antibody (Ser73)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit strong bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its potency has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. Metabolized through various transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, this drug specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains. With its ability to inhibit cell growth in culture, it proves to be an effective solution for combating tuberculosis infections.</p>

<p>The SARS-CoV-2 Spike Antibody is a powerful tool for detecting and studying the novel coronavirus. This antibody specifically targets the spike protein of the virus, which plays a crucial role in viral entry into host cells. It is produced through a hybridoma cell line, ensuring high specificity and sensitivity.</p>

<p>Rabbit polyclonal FFAR3 antibody</p>

<p>Rabbit polyclonal SYT antibody</p>

<p>Rabbit polyclonal NMT1 antibody</p>

<p>The DNMT3B antibody is a highly specialized monoclonal antibody that targets and inhibits the activity of DNMT3B, an enzyme involved in DNA methylation. This antibody has been shown to have anti-VEGF (vascular endothelial growth factor) properties, making it a potential therapeutic option for diseases characterized by abnormal blood vessel growth. Additionally, the DNMT3B antibody has been found to be nephrotoxic, affecting the kidneys' function. It interacts with endogenous hematopoietic cells and can bind to various proteins in human serum, including albumin and fibrinogen. The DNMT3B antibody is commonly used in life sciences research, particularly in studies related to insulin regulation and activation pathways. Whether you're looking to explore the role of DNMT3B in disease progression or investigate potential therapeutic interventions, this high-quality monoclonal antibody is an invaluable tool for your research endeavors.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATG16L1 antibody, catalog no. 70R-9631</p>

<p>The ErbB2 antibody is a highly effective and versatile product that offers a wide range of benefits. It contains sorafenib, an n-oxide compound that has been proven to inhibit the growth of cancer cells. Additionally, this antibody can be used in combination with other drugs such as doxorubicin to enhance their effectiveness.</p>

<p>Rabbit polyclonal UBE2K antibody</p>

<p>Sheep polyclonal 17a Estradiol antibody</p>

<p>CD49d antibody was raised in rat using the alpha-4 chain of the VLA-4 integrin heterodimer as the immunogen.</p>

<p>The PPARD antibody is a neutralizing antibody that belongs to the class of low-molecular-weight antibodies in the field of Life Sciences. It is a polyclonal antibody that specifically targets and inhibits the activity of PPARD, which is a growth factor receptor involved in various cellular processes. This antibody can be used as a therapeutic agent or research tool to study the role of PPARD in different biological systems. The PPARD antibody can be detected using techniques such as Western blotting or immunohistochemistry, and it can be conjugated to streptavidin or other molecules for specific applications. This antibody holds great potential for the development of novel medicaments and therapies targeting PPARD signaling pathways.</p>

<p>The HA tag antibody is a valuable tool in the field of Life Sciences. It is commonly used to detect and study proteins that have been tagged with the HA epitope. The HA tag, derived from the influenza hemagglutinin protein, consists of a short peptide sequence (YPYDVPDYA) that can be easily recognized by specific antibodies.</p>

<p>The PKR1 antibody is a highly specialized chemokine that is activated in various Life Sciences applications. This antibody has been extensively studied and proven to be effective in targeting fatty acids and growth factors. It is a monoclonal antibody that specifically targets the PKR1 receptor, which plays a crucial role in cell signaling pathways. The PKR1 antibody has shown remarkable results in inhibiting the growth of cancer cells, including MCF-7 breast cancer cells, by blocking the epidermal growth factor receptor pathway. Additionally, it has been used as an anti-CD33 antibody to target leukemia cells and as a mesenchymal stem cell inhibitor for research purposes. With its potent activity and specificity, the PKR1 antibody is a valuable tool for researchers working in the field of molecular biology and drug discovery.</p>

<p>NUDT9 antibody was raised using a synthetic peptide corresponding to a region with amino acids SPKFNEKDGHVERKSKNGLYEIENGRPRNPAGRTGLVGRGLLGRWGPNHA</p>

<p>beta NGF antibody was raised in mouse using highly pure recombinant human beta-NGF as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TOR1B antibody, catalog no. 70R-1899</p>

<p>Purified native Bovine Troponin I protein (Skeletal Muscle)</p>

<p>Rabbit polyclonal ZNF774 antibody</p>

<p>C5ORF39 antibody was raised using the N terminal Of C5Orf39 corresponding to a region with amino acids EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS</p>

<p>Rabbit anti-chicken IgG was raised in rabbit using chicken IgG F(ab')2 fragment as the immunogen.</p>

<p>KCTD4 antibody was raised using the middle region of KCTD4 corresponding to a region with amino acids RSQGLRIFCNAPDFISKIKSRIVLVSKSRLDGFPEEFSISSNIIQFKYFI</p>

<p>USF2 antibody was raised in mouse using recombinant H.Sapiens Usf2 Gene</p>

<p>The Estriol antibody is a powerful tool used in research and diagnostics. It is an antibody that specifically targets estriol, a hormone found in the human body. This antibody has been extensively studied for its role in various physiological processes.</p>

<p>Factor IX antibody was raised in sheep using human Factor IX purified from plasma as the immunogen.</p>

<p>EMG1 antibody was raised in Rabbit using Human EMG1 as the immunogen</p>