Bioquímicos e reagentes

<p>The JAK2 antibody is a glycoprotein that acts as a multidrug inhibitor. It specifically targets the p38 mitogen-activated protein, which plays a crucial role in various cellular processes. This antibody is widely used in Life Sciences research and has proven to be an effective tool for studying protein kinases and their functions.</p>

<p>Adenovirus antibody (FITC) was raised in goat using hexon from ADV, type 2 as the immunogen.</p>

<p>CD79b antibody was raised in hamster using the beta chain of the murine B-cell receptor as the immunogen.</p>

<p>Rabbit polyclonal HMG20B antibody</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>Rabbit polyclonal RAB3IP antibody</p>

<p>Rat monoclonal GILZ antibody (PE)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRAPPC2L antibody, catalog no. 70R-3900</p>

<p>ACE2 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGP</p>

<p>The DCK antibody is a monoclonal antibody that is activated and functions as a globulin. It possesses antiviral properties and acts as a natriuretic agent. This antibody is widely used in the field of Life Sciences for various applications, including neutralizing specific targets and serving as a family kinase inhibitor. Additionally, it has been found to have immobilization properties when used in conjunction with excipients. The DCK antibody can be utilized in research settings, such as in vitro studies involving human serum or electrode-based experiments. Its versatility makes it an essential tool for scientists and researchers in various fields.</p>

<p>ECEL1 antibody was raised in Rabbit using Human ECEL1 as the immunogen</p>

<p>Rabbit polyclonal 14-3-3 zeta theta antibody (Thr232)</p>

<p>BD2 antibody was raised in goat using highly pure recombinant human BD-2 as the immunogen.</p>

<p>Purified recombinant Human DDIT4 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC22A11 antibody, catalog no. 70R-1885</p>

<p>Rabbit polyclonal EGF antibody (HRP)</p>

<p>Rabbit polyclonal GPR124 antibody</p>

<p>GGA2 antibody was raised in Rabbit using Human GGA2 as the immunogen</p>

<p>113-271 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMSA PFSFLSNVKY NFMRIIKYEF ILNDALNQSI IRANDQYLTA AALHNLDEAV KFDMGAYKSS KDDAKITVIL RISKTQLYVT AQDEDQPVLL KEMPEIPKTI TGSETNLLFF WETHGTKNYF TSVAHPNLFI ATKQDYWVCL AGGPPSITDF QILENQA</p>

<p>Rabbit polyclonal MAP2K7 antibody (Ser271)</p>

<p>The SAP130 antibody is a highly specialized antibody used in Life Sciences research. It is known for its cytotoxic properties and its ability to target specific antigens. This antibody has been extensively tested and proven to have a strong antigen-antibody reaction, making it an ideal tool for various applications in the field.</p>

<p>Purified recombinant Human DHODH Protein (His tag)</p>

<p>Mouse monoclonal OSBPL11 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infections by targeting active compounds that exhibit bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has shown its high efficacy in human erythrocytes using a patch-clamp technique.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CENPH antibody, catalog no. 70R-5517</p>

<p>The FAK antibody is a highly effective monoclonal antibody used in Life Sciences. It belongs to the family of antibodies targeting specific growth factors, such as trastuzumab and adalimumab. This antibody specifically targets CD33, a protein expressed on the surface of certain cells. By neutralizing CD33, the FAK antibody inhibits the growth and proliferation of these cells.</p>

<p>Rabbit polyclonal OATP14 antibody</p>

<p>CDKN3 antibody was raised using a synthetic peptide corresponding to a region with amino acids CKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCG</p>

<p>ALDH1A2 antibody was raised in rabbit using the N terminal of ALDH1A2 as the immunogen</p>

<p>Rabbit polyclonal RAB40B antibody</p>

<p>Affinity purified Rabbit polyclonal STMN2 antibody</p>

<p>Purified Polyclonal TLE2 antibody</p>

<p>Rabbit polyclonal Fibronectin antibody (FITC)</p>

<p>HSPA4L antibody was raised using the C terminal of HSPA4L corresponding to a region with amino acids KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEI</p>

<p>Rat thrombocyte antibody (FITC) was raised in rabbit using rat thrombocytes as the immunogen.</p>

<p>Rabbit polyclonal NUCKS1 antibody</p>

<p>The Myc antibody is a powerful tool used in life sciences research. It is a monoclonal antibody that specifically targets the Myc protein, which plays a crucial role in cell growth and proliferation. This antibody has been extensively studied and proven to be highly effective in various applications.</p>

<p>GRHL3 antibody was raised in rabbit using the C terminal of GRHL3 as the immunogen</p>

<p>Rabbit polyclonal XRCC2 antibody</p>

<p>The alpha Synuclein antibody is a monoclonal antibody that specifically targets the alpha Synuclein protein. This antibody has been extensively studied in Life Sciences and has shown great potential for various applications. It has been found to have neutralizing properties against autoantibodies, which can be beneficial in certain autoimmune disorders. Additionally, the alpha Synuclein antibody has been shown to interact with ribulose and play a role in natriuretic and insulin signaling pathways. Its specificity towards the target molecule makes it a valuable tool for research in fields such as neurology, immunology, and molecular biology. Furthermore, this antibody has also demonstrated efficacy against pathogens like Cryptosporidium. With its wide range of applications and impressive performance, the alpha Synuclein antibody is an essential asset for any laboratory or research facility.</p>

<p>Rabbit polyclonal ZNF95 antibody</p>

<p>Rabbit polyclonal STAG1 antibody</p>

<p>TAFI antibody (HRP) was raised in sheep using human TAFI purified from plasma as the immunogen.</p>

<p>Mouse monoclonal RPN1 antibody</p>

<p>Rabbit polyclonal USP11 antibody</p>

<p>PPID antibody was raised using a synthetic peptide corresponding to a region with amino acids AECGELKEGDDGGIFPKDGSGDSHPDFPEDADIDLKDVDKILLITEDLKN</p>

<p>Rabbit polyclonal KAPC A/B antibody</p>

<p>MECR antibody was raised in Rabbit using Human MECR as the immunogen</p>

<p>Rabbit polyclonal SMD2 antibody (biotin)</p>

<p>ERLIN1 antibody was raised using the N terminal of ERLIN1 corresponding to a region with amino acids KNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFNKIH</p>

<p>HDAC4 antibody was raised in Mouse using a purified recombinant fragment of human HDAC4 expressed in E. coli as the immunogen.</p>

<p>LARP1 antibody was raised in Rabbit using Human LARP1 as the immunogen</p>

<p>Normal Goat Serum is an activated serum that is commonly used in Life Sciences research. It is a chemokine-rich serum with acidic properties, making it suitable for various applications. Normal Goat Serum can be used as a blocking agent to prevent non-specific binding of antibodies in immunohistochemistry and immunofluorescence experiments. It can also be used as a diluent or stabilizer for monoclonal antibodies, ensuring their optimal performance.</p>

<p>Rabbit Polyclonal Tau antibody (Ser422)</p>

<p>SLC7A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELWAFITGWNLILSYIIGTSSVARAWSATFDELIGRPIGEFSRTHMTLNA</p>

<p>The FPR1 antibody is a highly specialized product in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and is designed to neutralize specific chemokines. This antibody is widely used in research and laboratory settings for its ability to target and bind to FPR1 receptors.</p>

<p>Zfp113 antibody was raised in rabbit using the middle region of Zfp113 as the immunogen</p>

<p>CIRBP antibody was raised in Rabbit using Human CIRBP as the immunogen</p>

<p>Azaperone Conjugate for use in immunoassays</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thereby preventing bacterial growth. Extensive research has been conducted on this drug using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The oxidative metabolites of this drug undergo various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>DNASE2B antibody was raised using the C terminal of DNASE2B corresponding to a region with amino acids MAQRLKTHLLTETWQRKRQELPSNCSLPYHVYNIKAIKLSRHSYFSSYQD</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, which inhibits bacterial growth. Extensive research has demonstrated its high efficacy in human erythrocytes using a patch-clamp technique. Metabolically, it undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed at elevated levels in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.</p>

<p>Rabbit polyclonal Smad2 antibody (Ser250)</p>

<p>Purified recombinant ERLIN2 protein</p>

<p>PHF19 antibody was raised in rabbit using the C terminal of PHF19 as the immunogen</p>

<p>Purified recombinant NFKBID protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANXA5 antibody, catalog no. 70R-1669</p>

<p>FKTN antibody was raised in Rabbit using Human FKTN as the immunogen</p>

<p>Rabbit polyclonal TRAF4 antibody</p>

<p>Rabbit polyclonal USP2 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bacterial growth. This bactericidal activity is achieved through its ability to bind to DNA-dependent RNA polymerase, which effectively prevents transcription and replication. The effectiveness of this drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Moreover, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high affinity for markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>EPS8 antibody was raised in Rabbit using Human EPS8 as the immunogen</p>

<p>Rabbit anti-sheep IgG (H+L) (Alk Phos) was raised in rabbit using sheep IgG whole molecule as the immunogen.</p>

<p>Rabbit polyclonal NDUFV2 antibody (biotin)</p>

<p>Rabbit polyclonal PDGF Receptor beta antibody (Tyr751)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BC37295_3 antibody, catalog no. 70R-8171</p>

<p>Rabbit polyclonal DIRA1 antibody</p>

<p>Mouse antigen staining reagent for use in IHC</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACPT antibody, catalog no. 70R-7296</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of THNSL2 antibody, catalog no. 70R-4062</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SEPP1 antibody, catalog no. 70R-2714</p>

<p>Calpastatin antibody was raised in mouse using purified bovine skeletal muscle 80 kDa subunit of m-Calpastatin as the immunogen.</p>

<p>Rabbit polyclonal SLC7A4 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KLHL4 antibody, catalog no. 70R-8342</p>

<p>Purified Rabbit polyclonal MGST3 antibody</p>

<p>MUC12 antibody was raised using the middle region of MUC12 corresponding to a region with amino acids PSVLVGDSTPSPISSGSMETTALPGSTTKPGLSEKSTTFYSSPRSPDTTH</p>

<p>OCA2 antibody was raised using the middle region of OCA2 corresponding to a region with amino acids LIAEVIFTNIGGAATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFIGIC</p>

<p>COL8A1 antibody was raised in Rabbit using Human COL8A1 as the immunogen</p>

<p>ACSM3 antibody was raised in rabbit using the N terminal of ACSM3 as the immunogen</p>

<p>Purified Polyclonal Cerebellin 1 antibody</p>

<p>IRF2BP2 antibody was raised in Rabbit using Human IRF2BP2 as the immunogen</p>

<p>Mouse monoclonal KHK antibody</p>

<p>MIF4GD antibody was raised using the N terminal of MIF4GD corresponding to a region with amino acids MGEPSREEYKIQSFDAETQQLLKTALKVACFETEDGEYSVCQRSYSNCSR</p>

<p>Mouse monoclonal THOP1 antibody</p>

<p>ERAS antibody was raised using the middle region of ERAS corresponding to a region with amino acids AQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAF</p>

<p>Rabbit polyclonal F3 antibody (Ser290)</p>

<p>TDP1 antibody was raised in mouse using recombinant human TDP1 (1-298aa) purified from E. coli as the immunogen.</p>

<p>ZNF555 antibody was raised in rabbit using the N terminal of ZNF555 as the immunogen</p>

<p>CCIN antibody was raised in rabbit using the N terminal of CCIN as the immunogen</p>

<p>The DDX24 antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically binds to nuclear binding proteins. This monoclonal antibody is highly activated and can be used for various applications in research and medicine.</p>