Bioquímicos e reagentes

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of YWHAZ antibody, catalog no. 70R-3632</p>

<p>MAP2K2 antibody was raised in Rabbit using Human MAP2K2 as the immunogen</p>

<p>The NNMT antibody is a highly effective medicament used in the field of Life Sciences. It is specifically designed to target and bind to the NNMT protein, enabling researchers to study its functions and interactions in various biological processes. This monoclonal antibody exhibits a strong antigen-antibody reaction, allowing for precise detection and analysis of NNMT in samples.</p>

<p>Ribophorin I antibody was raised using the N terminal of RPN1 corresponding to a region with amino acids TSRATSFLLALEPELEARLAHLGVQVKGEDEEENNLEVRETKIKGKSGRF</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GABARAP antibody, catalog no. 70R-9080</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX55 antibody, catalog no. 70R-4786</p>

<p>Oleic estolide is a hydrocarbons-based conditioning agent with a high viscosity. It is an ester of oleic acid and ethanol. The molecule consists of an ester linkage between the hydroxy group of the fatty acid and the hydroxyl group of the ethanol. This compound has been shown to be an effective conditioning agent in hair care products, while also being used as a chemical intermediate for other compounds such as ruthenium complexes. Oleic estolide can also be synthesized from fatty acids and monocarboxylic acid, or from fatty acid and fatty esters.</p>

<p>The PKC alpha antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to protein kinase C alpha (PKC alpha), an enzyme involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>Rabbit polyclonal KAL1 antibody</p>

<p>ABCF3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLL</p>

<p>Eif2c3 antibody was raised in rabbit using the N terminal of Eif2c3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CNN2 antibody, catalog no. 70R-2395</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIF5B antibody, catalog no. 70R-5599</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C9orf68 antibody, catalog no. 70R-4309</p>

<p>Rabbit polyclonal PRNP antibody</p>

<p>Mouse monoclonal DENV2 ED2 antibody</p>

<p>IDH3A antibody was raised using a synthetic peptide corresponding to a region with amino acids MKIFDAAKAPIQWEERNVTAIQGPGGKWMIPSEAKESMDKNKMGLKGPLK</p>

<p>PRPF3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VDKLFEAVEEGRSSRHSKSSSDRSRKRELKEVFGDDSEISKESSGVKKRR</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Pnpla6 antibody, catalog no. 70R-8660</p>

<p>Region of NP1 protein corresponding to amino acids ACYCRIPACI AGERRYGYCI YQGRLWAFCC.</p>

<p>Rabbit polyclonal HNF4 alpha/gamma antibody</p>

<p>AQYEDGKQYT TLEKPVAGAP QVLEFFSFFC PHCYQFEEVL HISDNVKKKL PEGVKMTKYH VNFMGGDLGK DLTQAWAVAM ALGVEDKVTV PLFEGVQKTQ TIRSASDIRD VFINAGIKGE EYDAAWNSFV VKSLVAQQEK AAADVQLRGV PAMFVNGKYQ LNPQGMDTSN MDVFVQQYAD TVKYLSEKK</p>

<p>GRAP antibody was raised in Rabbit using Human GRAP as the immunogen</p>

<p>The Caspase 1 antibody is a powerful tool used in various assays and research studies in the field of Life Sciences. It is an inhibitor that specifically targets caspase 1, which is a protease involved in the activation of inflammatory cytokines. This antibody can be used to neutralize the activity of caspase 1 and study its role in different cellular processes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GDAP2 antibody, catalog no. 70R-4452</p>

<p>Factor IX antibody was raised in sheep using human Factor IX purified from plasma as the immunogen.</p>

<p>DPYS antibody was raised using the N terminal of DPYS corresponding to a region with amino acids VLDAAGKLVLPGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIID</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF614 antibody, catalog no. 70R-8380</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAB15 antibody, catalog no. 70R-9363</p>

<p>The STAT5A antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to the STAT5A protein. This protein plays a crucial role in cell signaling pathways and is involved in various biological processes, including cell growth, differentiation, and immune response.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC19 antibody, catalog no. 70R-1957</p>

<p>Purified Polyclonal PECI antibody</p>

<p>The Chlorpyrifos antibody is a growth factor that specifically targets messenger RNA (mRNA) molecules. It is a monoclonal antibody that is designed to detect and bind to contaminants, such as chlorpyrifos, in various samples. This antibody is widely used in the field of Life Sciences for applications such as immunoassays and polymerase chain reactions (PCR). The Chlorpyrifos antibody offers high specificity and sensitivity, making it an ideal choice for researchers and scientists working in environmental monitoring, agriculture, and toxicology. With its excellent chemical stability and long shelf life, this antibody ensures reliable results and consistent performance. Whether you need to detect chlorpyrifos residues or develop a medicament for exposure prevention, the Chlorpyrifos antibody is your go-to solution. Choose from our wide range of options, including gold nanoparticle-conjugated antibodies or polyclonal antibodies, to suit your specific research needs.</p>

<p>Rabbit polyclonal POPDC3 antibody</p>

<p>NFKB2 antibody was raised in Rabbit using Human NFKB2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OXCT2 antibody, catalog no. 70R-5373</p>

<p>Affinity purified Rabbit polyclonal BRE antibody</p>

<p>The Estrogen Receptor alpha antibody is a highly effective monoclonal antibody that specifically targets the estrogen receptor alpha (ERα) protein. This antibody plays a crucial role in various biological processes, including cell growth, differentiation, and development. It has been extensively used in research studies to investigate the role of ERα in different diseases and conditions.</p>

<p>Slc26a2 antibody was raised in rabbit using the C terminal of Slc26a2 as the immunogen</p>

<p>The CD66e antibody is a highly specialized antibody that targets the carbonyl group of the HER2 protein. It is available in both polyclonal and monoclonal forms, making it suitable for a wide range of applications in the field of Life Sciences. This antibody specifically binds to the epidermal growth factor receptor (EGFR) and inhibits its activity, thereby preventing the growth and proliferation of cancer cells.</p>

<p>The GAPDH antibody is a highly effective tool used in Life Sciences research. It is a glycoprotein that specifically targets and binds to glyceraldehyde-3-phosphate dehydrogenase (GAPDH), an enzyme involved in glycolysis. This monoclonal antibody has been extensively tested and validated for use in various applications, including Western blotting, immunohistochemistry, and ELISA.</p>

<p>Region of I309 protein corresponding to amino acids SKSMQVPFSR CCFSFAEQEI PLRAILCYRN TSSICSNEGL IFKLKRGKEA CALDTVGWVQ RHRKMLRHCP SKRK.</p>

<p>Purified Recombinant Angiopoietin receptor protein (His tagged)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZBTB7C antibody, catalog no. 20R-1080</p>

<p>Mouse monoclonal SWAP70 antibody</p>

<p>Neomycin-BSA is a unique product in the field of Life Sciences. It is a monoclonal antibody that specifically targets endothelial cadherin, a protein involved in cell adhesion and signaling. This antibody has been extensively studied for its neutralizing properties and has shown promising results in inhibiting the function of endothelial cadherin.</p>

<p>Rat monoclonal CD86 antibody (PE)</p>

<p>The ELTD1 antibody is a highly specialized antibody that targets the ELTD1 protein, which is involved in various biological processes. This antibody is commonly used in life sciences research and has been extensively studied for its role in steroid metabolism. It can be used as a tool for studying the function and localization of ELTD1 in different cell types.</p>

<p>Rabbit polyclonal NXF3 antibody</p>

<p>Plakophilin 3 antibody was raised in Guinea Pig using human recombinant plakophilin 3 peptide purified from E. coli as the immunogen.</p>

<p>Rabbit Polyclonal IkB epsilon antibody (Ser22)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HMGCL antibody, catalog no. 70R-5397</p>

<p>Rabbit polyclonal OLFML2A antibody</p>

<p>Purified recombinant PLSCR3 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TXNIP antibody, catalog no. 70R-2031</p>

<p>The SPP1 Blocking Peptide is an activated peptide that falls under the category of Blocking Peptides. It acts as a growth factor and helps regulate the density of low-density lipoproteins in the body. Additionally, it has been shown to reduce cortisol concentration levels and inhibit the binding of vitronectin to certain receptors. The SPP1 Blocking Peptide can be used in various applications such as monoclonal antibody production, electrode coating, and as inhibitors for cortisol or steroid-related experiments. It finds wide usage in the field of Life Sciences and can be combined with other active agents like trastuzumab or other antibodies for enhanced effects.</p>

<p>Mouse monoclonal RAD9A antibody</p>

<p>P2rx2 antibody was raised in rabbit using the middle region of P2rx2 as the immunogen</p>

<p>Please enquire for more information about Betulinic acid propargyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TAC3 antibody, catalog no. 70R-5340</p>

<p>The PSR antibody is a highly specialized monoclonal antibody used in various assays and research studies in the field of Life Sciences. It is specifically designed to target alpha-synuclein (α-syn), a protein associated with neurodegenerative disorders such as Parkinson's disease.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OR1L8 antibody, catalog no. 70R-9853</p>

<p>Rabbit polyclonal ERP29 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC26A8 antibody, catalog no. 70R-1764</p>

<p>Rabbit polyclonal CD3E antibody (FITC)</p>

<p>CIDEC antibody is a polyclonal antibody that is commonly used in life sciences research. It is specifically designed to detect and bind to CIDEC, an antigen that plays a crucial role in lipid metabolism and energy homeostasis. This antibody has been extensively validated for use in immunohistochemistry and other applications.</p>

<p>NAT5 antibody was raised in Rabbit using Human NAT5 as the immunogen</p>

<p>APOBEC3C antibody was raised in Rabbit using Human APOBEC3C as the immunogen</p>

<p>GPR115 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Bromoacetamido-dPEG®11-Azide is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Bromoacetamido-dPEG®11-Azide is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>MSH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KMSAVDGQRQVGVGYVDSIQRKLGLCEFPDNDQFSNLEALLIQIGPKECV</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of INSIG1 antibody, catalog no. 70R-6636</p>

<p>Affinity purified Rabbit polyclonal RAMP1 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection and is considered one of the most effective compounds for treating this condition. The drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, thus preventing transcription and replication. Extensive research has shown its high efficacy in human erythrocytes using a patch-clamp technique. Its active form undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their growth in culture.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FETUB antibody, catalog no. 70R-5424</p>

<p>AK1 antibody was raised in Rabbit using Human AK1 as the immunogen</p>

<p>KCNJ8 antibody was raised in Rabbit using Human KCNJ8 as the immunogen</p>

<p>Vitamin D3 Antibody is a monoclonal antibody that specifically targets and recognizes vitamin D3. This antibody is widely used in the field of life sciences for various applications, including research on sumoylation, insulin-like growth factor signaling, interferon response, and more. It can be utilized to detect and quantify vitamin D3 levels in biological samples or to study its interactions with other molecules such as alpha-synuclein. The Vitamin D3 Antibody is highly specific and exhibits strong affinity towards its target antigen, making it an essential tool for scientists working with recombinant proteins, tyrosine metabolism, fatty acid synthesis, and growth factors. With its immobilized form, this antibody provides convenience and reliability in experimental setups.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Lpcat2 antibody, catalog no. 70R-8680</p>

<p>Akt, also known as Protein Kinase B (PKB), is a serine/threonine-specific kinase crucial for regulating key cellular functions, including growth, survival, metabolism, and proliferation. It operates within the PI3K/Akt/mTOR pathway, which integrates external signals to maintain cellular function and adaptation. Humans express three Akt isoforms—Akt1, Akt2, and Akt3—each encoded by a distinct gene. The activation of Akt generally starts when external signals like growth factors or insulin bind to cell surface receptors, activating phosphoinositide 3-kinase (PI3K). This leads to the production of phosphatidylinositol (3,4,5)-trisphosphate (PIP3) on the cell membrane, which attracts Akt to the membrane, where it undergoes phosphorylation at two specific sites, Thr308 and Ser473, to become fully active. Once activated, Akt moves through the cell to phosphorylate target proteins involved in various cellular pathways.The primary functions of Akt include promoting cell survival by inhibiting apoptosis through the inactivation of pro-apoptotic proteins like BAD and Caspase-9. It also supports cell growth and proliferation by activating mTOR, a central regulator of protein synthesis, while suppressing growth-arrest pathways. Akt plays a key role in metabolic regulation by increasing glucose uptake and glycolysis, largely through GLUT4 translocation and hexokinase activation, which is particularly important in muscle and fat tissues. It contributes to angiogenesis by upregulating VEGF expression, aiding tissue growth and repair, and it promotes cell migration, facilitating wound healing as well as the spread of cancer cells in malignancy. Due to its broad role in cell survival and growth, Akt is often hyperactivated in cancers, driving unchecked cell division and tumor growth, which makes the PI3K/Akt/mTOR pathway a target for many cancer therapies. Additionally, Akt's role in glucose metabolism links it to insulin signaling, where defects can impair glucose uptake, leading to insulin resistance and type 2 diabetes.</p>

<p>TES-991 is a reactive, inflammatory disease that belongs to the class of sirtuin inhibitors. It is a synthetic compound that has been shown to be effective against a range of diseases such as cardiovascular disorders, type 2 diabetes, and cancer. TES-991 inhibits the activity of SIRT1, which is an enzyme that regulates metabolism and inflammation. TES-991 is able to inhibit the production of fatty acids in cells by interfering with the synthesis of long chain polyunsaturated fatty acids (PUFA) in mitochondria. TES-991 also inhibits mitochondrial DNA mutation by binding to one or more molecular targets in mitochondria and preventing them from being activated by reactive oxygen species. This drug has been shown to be effective in animal models of spontaneous caenorhabditis elegans (Ce), cisplatin-induced Ce, and genetic Ce.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIF23 antibody, catalog no. 70R-5564</p>

<p>Purified recombinant Human ACADVL protein</p>

<p>The NFKB1 antibody is a powerful tool for researchers studying the role of nuclear factor kappa B (NFKB) in various cellular processes. This monoclonal antibody specifically targets the NFKB1 protein, which plays a crucial role in regulating gene expression and immune responses. It can be used to detect and quantify NFKB1 levels in different cell types and tissues.</p>

<p>SMYD1 antibody was raised in rabbit using the middle region of SMYD1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CHMP4B antibody, catalog no. 70R-4493</p>

<p>Affinity purified Rabbit polyclonal TC21 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Snx10 antibody, catalog no. 70R-9294</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PAICS antibody, catalog no. 70R-3667</p>

<p>Rabbit polyclonal SULT2A1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TSHR antibody, catalog no. 70R-6004</p>

<p>The ZMAT3 antibody is a highly specialized monoclonal antibody that targets the TGF-β1 and erythropoietin receptor. It has been extensively tested and proven to detect autoantibodies in human serum samples. This antibody is commonly used in research laboratories and life sciences industries for various applications, including immunoassays, Western blotting, and immunohistochemistry.</p>

<p>Purified recombinant Human DNAJC12 protein (His tag)</p>

<p>The IL7 antibody is a powerful tool in the field of life sciences. This antibody specifically targets autoantibodies and human serum albumin, making it an essential component for various research applications. It has an EGF-like structure and acts as a chemokine and growth factor, promoting cell proliferation and survival. Additionally, the IL7 antibody has neutralizing properties against vasoactive intestinal peptide (VIP), further expanding its potential applications in immunology studies. With its high specificity and affinity for serum albumin, this antibody can be used in chromatographic techniques to isolate and purify proteins of interest. Whether you need polyclonal or monoclonal antibodies, the IL7 antibody is a valuable asset for your research endeavors.</p>

<p>HIP1R antibody was raised in Rabbit using Human HIP1R as the immunogen</p>

<p>Evenamide is a pharmaceutical drug that is used in the treatment of Parkinson's disease. It is a potent and selective inhibitor of ectopic expression of trifluoromethyl-CoA reductase, which is an enzyme involved in the synthesis of fatty acids. This agent has also been shown to be effective against symptoms of schizophrenia. Evenamide was found to be statistically significant for treating symptoms in schizophrenic patients and has been shown to reduce hyperactivity and voltage-gated Na+ currents.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MTRF1L antibody, catalog no. 70R-2498</p>

<p>The HDAC10 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. This antibody specifically targets and binds to histidine deacetylase 10 (HDAC10), an enzyme involved in regulating gene expression. By binding to HDAC10, this antibody activates certain biological processes and pathways.</p>

<p>Rabbit polyclonal S6K alpha 6 antibody</p>

<p>IL1 alpha antibody was raised in rabbit using highly pure recombinant human IL-1-alpha as the immunogen.</p>