Bioquímicos e reagentes

<p>C14ORF101 antibody was raised in rabbit using the N terminal of C14ORF101 as the immunogen</p>

<p>Purified Polyclonal GRB10 antibody</p>

<p>GJC1 antibody was raised using the middle region of GJC1 corresponding to a region with amino acids ERLDLAVQAYSHQNNPHGPREKKAKVGSKAGSNKSTASSKSGDGKTSVWI</p>

<p>BDH1 antibody was raised in Rabbit using Human BDH1 as the immunogen</p>

<p>The Beta tubulin antibody is a monoclonal antibody that specifically targets the beta tubulin protein. This antibody has been widely used in research and diagnostics in the field of Life Sciences. It can be used to study various cellular processes, including cell division, intracellular transport, and cytoskeleton organization.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infection and contains active compounds that exhibit strong bactericidal activity. Through its unique mechanism of action, this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been proven through extensive research using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes various metabolic transformations including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. With its ability to specifically bind to markers expressed in Mycobacterium tuberculosis strains, it effectively inhibits cell growth in culture.</p>

<p>Rabbit polyclonal YWHAB antibody</p>

<p>Purified Polyclonal Glycerol Kinase 2 antibody</p>

<p>ABCB1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>PTGES3 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKM</p>

<p>GHR antibody was raised using the N terminal of GHR corresponding to a region with amino acids LQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLF</p>

<p>Recombinant Human STK11 protein (His tag)</p>

<p>C7orf58 antibody was raised in Rabbit using Human C7orf58 as the immunogen</p>

<p>The VEGFR1 antibody is a powerful diagnostic reagent used in Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes Vascular Endothelial Growth Factor Receptor 1 (VEGFR1). This antibody has cytotoxic properties and is reactive against various growth factors. It can be used for the quantitation of VEGFR1 expression in different tissues, including adipose tissue. The VEGFR1 antibody is highly specific and can be used as an inhibitor in research studies or as a diagnostic tool in clinical settings. Its polymorphic nature allows for versatility and adaptability to different experimental conditions. With its high-quality production and reliable performance, this antibody is an essential tool for researchers and clinicians alike.</p>

<p>Sarcospan antibody was raised using a synthetic peptide corresponding to a region with amino acids AHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKL</p>

<p>SDCBP antibody was raised using a synthetic peptide corresponding to a region with amino acids NSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDR</p>

<p>PARP antibody was raised in Mouse using synthetic peptide of human PARP, conjugated to KLH as the immunogen.</p>

<p>Mouse monoclonal CST3 antibody</p>

<p>OR2W5 antibody was raised using the middle region of OR2W5 corresponding to a region with amino acids SGEVPDSLLHHRHSQHQPPHLHFEEQGCEGDHEETSGVGERGWGASTRGT</p>

<p>Mouse monoclonal PSMB9 antibody</p>

<p>MATR3 antibody was raised in mouse using recombinant Human Matrin 3 (Matr3)</p>

<p>The ANXA3 antibody is a powerful tool for ultrasensitive detection in the field of Life Sciences. It is a Polyclonal Antibody that specifically targets collagen, a crucial biomolecule involved in various biological processes. This antibody has been extensively tested and proven to be reactive with human serum, making it an ideal choice for diagnostic applications.</p>

<p>MDVFMKGLSK AKEGVVAAAE KTKQGVAEAA GKTKEGVLYV GSKTKEGVVH GVATVAEKTK GTEIWMKKDQ LGKNEEGAPQ EGILEDMPVD PDNEAYEMPS EEGYQDYEPE A</p>

<p>Purified recombinant BMP8B protein (His tag)</p>

<p>Rabbit polyclonal GPBAR antibody</p>

<p>Rabbit polyclonal PTTG1IP antibody</p>

<p>Mouse monoclonal CD90.1 antibody (PE)</p>

<p>Mouse monoclonal KCTD14 antibody</p>

<p>PARP6 antibody was raised in rabbit using the N terminal of PARP6 as the immunogen</p>

<p>ALDH1A1 antibody was raised in Mouse using a purified recombinant fragment of human ALDH1A1 expressed in E. coli as the immunogen.</p>

<p>Purified recombinant RPL35A protein (His tag)</p>

<p>The Methcathinone antibody is a highly effective neutralizing agent used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and is specifically designed to target autoantibodies. This antibody has shown remarkable efficacy in inhibiting the activity of acidic molecules such as β-catenin and TGF-beta1 (also known as TGF-β1). Additionally, it has been proven effective in blocking the action of trastuzumab, fibronectin, collagen, and alpha-fetoprotein. The Methcathinone antibody is widely recognized for its exceptional binding affinity and specificity towards TGF-beta, making it an invaluable tool in protein research and therapeutic applications.</p>

<p>Salmeterol Conjugate for use in immunoassays</p>

<p>Mouse monoclonal NDUFA7 antibody</p>

<p>MESP1 antibody was raised in rabbit using the N terminal of MESP1 as the immunogen</p>

<p>LGI1 antibody was raised in Rabbit using Human LGI1 as the immunogen</p>

<p>FAM84A antibody was raised using the N terminal of FAM84A corresponding to a region with amino acids GNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPD</p>

<p>Rat monoclonal LPAM1 antibody (allophycocyanin)</p>

<p>The PKR antibody is a monoclonal antibody that targets the protein kinase R (PKR), an enzyme involved in cellular responses to stress and viral infection. This antibody specifically binds to PKR, preventing its activation and inhibiting its downstream signaling pathways. The PKR antibody has been widely used in Life Sciences research, particularly in studies related to epidermal growth factor (EGF) signaling and cancer biology. It has also been used as a family kinase inhibitor in various experimental settings. The PKR antibody can be utilized for applications such as Western blotting, immunoprecipitation, and immunofluorescence. With its high specificity and affinity, this antibody is a valuable tool for researchers studying the role of PKR in cellular processes and disease development.</p>

<p>The PLK1 antibody is a highly effective inhibitor that belongs to the class of monoclonal antibodies. It specifically targets and binds to the PLK1 protein, which is primarily found in the nucleus of cells. This antibody has been extensively studied and proven to be highly specific and sensitive in detecting PLK1 expression levels.</p>

<p>ERP29 antibody was raised using the N terminal of ERP29 corresponding to a region with amino acids MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVI</p>

<p>Rabbit polyclonal Transferrin antibody (FITC)</p>

<p>SB 258719 is a selective 5-HT1A receptor antagonist, which is a type of pharmacological agent that binds to and inhibits the activity of the 5-HT1A receptor. It is synthesized from chemical compounds typically used in neurobiological research. The mode of action involves the competitive blockade of serotonin (5-HT) at the 5-HT1A receptor sites, thereby preventing serotonin from activating these receptors in the brain.</p>

<p>Purified Polyclonal FSBP antibody</p>

<p>HAV VP3 antibody is a monoclonal antibody that specifically targets the HAV VP3 protein. It is commonly used in life sciences research to study the role of this protein in various biological processes. This antibody has been shown to bind to actin filaments, nuclear proteins, and albumin, making it a versatile tool for studying protein interactions and localization. Additionally, HAV VP3 antibody has been used in studies involving atypical hemolytic uremic syndrome and Brucella abortus infection. With its high specificity and affinity, this monoclonal antibody is a valuable asset for researchers in the field of immunology and molecular biology.</p>

<p>Purified recombinant p15 Treponema pallidum protein</p>

<p>Granzyme A antibody was raised using a synthetic peptide corresponding to a region with amino acids TREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNS</p>

<p>PTPN2 antibody was raised using the middle region of PTPN2 corresponding to a region with amino acids ESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGDDINIKQVLLN</p>

<p>The RIPK2 antibody is a highly specialized monoclonal antibody that targets the protein complex involved in various cellular processes, including growth factor signaling and transferrin metabolism. This antibody specifically recognizes RIPK2, a nuclear receptor that plays a crucial role in the regulation of biomolecules such as mineralocorticoid receptors. The RIPK2 antibody can be used for research purposes to study the function and localization of RIPK2 in different cell types.</p>

<p>Rabbit polyclonal alpha 1 Antitrypsin antibody (Prediluted for IHC)</p>

<p>Mouse monoclonal MPP3 antibody</p>

<p>Purified Recombinant CD135 protein (His tagged)</p>

<p>The PTH antibody is a highly specialized antibody used in Life Sciences research. It is designed to specifically target and inhibit the action of parathyroid hormone (PTH), a hormone peptide involved in regulating calcium and phosphate levels in the body. This monoclonal antibody can be used as a powerful tool for studying the role of PTH in various biological processes.</p>

<p>ABCC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids KVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRYQQTLEACALLADL</p>

<p>Rabbit polyclonal CEB beta antibody (Thr235/188)</p>

<p>Protein C antibody was raised in sheep using mouse protein C as the immunogen.</p>

<p>PUMA antibody was raised in rabbit using 17 residue sequence 29-55 [EQHLESPVPSAPGALAG] found in the exon-3-encoded region in the human PUMA-Alpha and PUMA-Beta forms of the protein as the immunogen.</p>

<p>The ZHX2 antibody is a powerful tool used in the field of Life Sciences. It specifically targets and binds to collagen, a protein found abundantly in the body. This antibody has shown antinociceptive properties, meaning it can help alleviate pain sensations. Additionally, it has been observed to be effective in inhibiting the activation of certain phosphorylation sites, which play a crucial role in cellular signaling pathways.</p>

<p>MYST1 antibody was raised using the N terminal of MYST1 corresponding to a region with amino acids MAAQGAAAAVAAGTSGVAGEGEPGPGENAAAEGTAPSPGRVSPPTPARGE</p>

<p>Purified Rabbit polyclonal VEGFR2 antibody (Tyr1059)</p>

<p>Purified Polyclonal Cytochrome P450 11A1 antibody</p>

<p>Olaquindox Conjugate for use in immunoassays</p>

<p>SHMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYG</p>

<p>Rat monoclonal CX3CR1 antibody (biotin)</p>

<p>The OCT2 antibody is a highly effective monoclonal antibody that is used in Life Sciences research. This antibody specifically targets and binds to the OCT2 protein, which is a key player in various cellular processes. By forming an antibody complex with OCT2, this antibody inhibits the activity of protein kinases and other enzymes involved in cellular signaling pathways.</p>

<p>The ACLY antibody is a monoclonal antibody that specifically targets and inhibits the activity of ACLY (ATP citrate lyase), an enzyme involved in fatty acid synthesis. This antibody has been shown to reduce the viscosity of monoclonal antibodies, making it a valuable tool for improving the formulation and stability of therapeutic antibodies. In addition to its role in fatty acid synthesis, ACLY has also been implicated in various cellular processes, including epidermal growth factor signaling, chemokine production, and interleukin-6 expression. By targeting ACLY with this specific antibody, researchers can gain insights into its function and potential as a therapeutic target. The ACLY antibody is highly specific and exhibits low cross-reactivity with other proteins, making it an ideal choice for research applications.</p>

<p>HS2ST1 antibody was raised in Rabbit using Human HS2ST1 as the immunogen</p>

<p>ZNF409 antibody was raised in rabbit using the middle region of ZNF409 as the immunogen</p>

<p>CD4 antibody (PE) was raised in mouse using CD4+ transfectant/human CEM as the immunogen.</p>

<p>Rabbit polyclonal OR10J1 antibody</p>

<p>317-546 amino acids: MGSSHHHHHH SSGLVPRGSH MEGKEEPGSD SGTTAVVALI RGKQLIVANA GDSRCVVSEA GKALDMSYDH KPEDEVELAR IKNAGGKVTM DGRVNGGLNL SRAIGDHFYK RNKNLPPEEQ MISALPDIKV LTLTDDHEFM VIACDGIWNV MSSQEVVDFI QSKISQRDEN GELRLLSSIV EELLDQCLAP DTSGDGTGCD NMTCIIICFK PRNTAELQPE SGKRKLEEVL STEGAEENGN SDKKKKAKRD</p>

<p>KNG1 antibody was raised using the middle region of KNG1 corresponding to a region with amino acids YPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK</p>

<p>Rabbit polyclonal CEP57 antibody</p>

<p>Rabbit polyclonal BCL2 antibody (Thr56)</p>

<p>RNF167 antibody was raised in rabbit using the middle region of RNF167 as the immunogen</p>

<p>Rabbit polyclonal SREBF2 antibody</p>

<p>Rabbit polyclonal SCYL2 antibody</p>

<p>GFP antibody was raised in mouse using a GFP fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria as the immunogen.</p>

<p>Rabbit polyclonal DFFA antibody</p>

<p>Mouse monoclonal MAP2K4 antibody</p>

<p>The SERPINE1 antibody is a highly specialized antibody that targets the glutamate receptor. It belongs to the class of polyclonal antibodies and has been extensively studied in the field of Life Sciences. This antibody specifically interacts with β-catenin, a protein involved in cell adhesion and signaling pathways. It also inhibits the activity of colony-stimulating factors, which are important for immune response regulation. The SERPINE1 antibody has been shown to be reactive against various monoclonal antibodies, making it a versatile tool for research purposes. Additionally, it exhibits cytotoxic effects on pluripotent cells and can inhibit the activity of protein kinases, including oncogenic kinases. This monoclonal antibody is non-phosphorylated, ensuring its stability and effectiveness in experimental settings. With its wide range of applications in molecular biology and immunology research, the SERPINE1 antibody is an invaluable tool for scientists seeking to unravel complex cellular mechanisms.</p>

<p>Rabbit polyclonal RIMS3 antibody</p>

<p>ALDOC antibody was raised using the C terminal of ALDOC corresponding to a region with amino acids CPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAA</p>

<p>Mouse monoclonal PLEK antibody</p>

<p>Rabbit polyclonal PPAR gamma antibody (Ser112)</p>

<p>Rabbit polyclonal SPHK1 antibody</p>

<p>Purified recombinant JAM3 protein (His tag)</p>

<p>Rabbit polyclonal COL4A1 antibody (HRP)</p>

<p>Mouse monoclonal Myosin antibody</p>

<p>Mouse monoclonal EFNA2 antibody</p>

<p>The Keratin 18 antibody is a nanocomposite that consists of a DNA aptamer with an amino group. It can be used in Life Sciences research to study the growth factor and protein kinases involved in various cellular processes. The antibody specifically targets Keratin 18, which is a protein expressed in epithelial cells. This monoclonal antibody allows for the detection and visualization of Keratin 18 through an antigen-antibody reaction. It can be used in applications such as immunofluorescence staining, western blotting, and polymerase chain reactions (PCR). The Keratin 18 antibody is highly specific and sensitive, making it a valuable tool for researchers studying cellular biology and disease mechanisms.</p>

<p>Rabbit polyclonal GPR92 antibody</p>

<p>Purified Polyclonal MYST4 antibody</p>

<p>FSH antibody was raised in mouse using high purity intact FSH from human pituitary gland as the immunogen.</p>

<p>Haptoglobin antibody was raised against Human Haptoglobin.</p>

<p>PIGQ antibody was raised using the N terminal of PIGQ corresponding to a region with amino acids PTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRFDEGPVRLSHWQS</p>

<p>Mouse monoclonal NT5DC1 antibody</p>

<p>Purified recombinant HOXC11 protein (His tag)</p>

<p>Rabbit polyclonal Caspase 1 antibody (FITC)</p>

<p>Mouse monoclonal OMP28 antibody</p>