Bioquímicos e reagentes

<p>Purified Rabbit polyclonal ACVR1B antibody</p>

<p>Purified recombinant SIAH1 protein (His tag)</p>

<p>Avilamycin Conjugate for use in immunoassays</p>

<p>Purified Rabbit polyclonal EIF2AK1 antibody</p>

<p>UBE2M antibody was raised using a synthetic peptide corresponding to a region with amino acids IKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISF</p>

<p>NDUFA9 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPY</p>

<p>The nNOS antibody is a highly effective tool in the field of atypical hemolytic research. It is specifically designed to target and detect brucella abortus, a bacterium that causes serious infections in animals and humans. This antibody belongs to the class of polyclonal antibodies, which means it can recognize multiple epitopes on the target protein.</p>

<p>Toxoplasma gondii protein is a versatile and essential component in the field of Life Sciences. This protein exhibits various characteristics that make it highly valuable for research purposes. It possesses epidermal growth factor properties, making it an excellent candidate for studying cellular growth and development. Additionally, Toxoplasma gondii protein has been found to have neutralizing effects, which can be utilized in the development of therapeutic interventions.</p>

<p>Sheep polyclonal Flunixin antibody</p>

<p>Purified recombinant PRRT2 protein (His tag)</p>

<p>Tead4 antibody was raised in rabbit using the middle region of Tead4 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MYOZ1 antibody, catalog no. 70R-2197</p>

<p>Rabbit polyclonal KLHDC2 antibody</p>

<p>Rat monoclonal CIRE antibody (biotin)</p>

<p>Cathepsin B protein is a versatile enzyme that plays a crucial role in various biological processes. It is commonly used in research and diagnostic applications. Cathepsin B protein can be easily activated using an electrode or other suitable methods. It is often used in studies involving human serum, where it helps to understand the mechanisms of certain diseases. Monoclonal antibodies specific to Cathepsin B protein are available, which enable researchers to study its functions and interactions with other proteins. Recombinant proteins of Cathepsin B are also widely used in various experiments and assays.</p>

<p>Purified recombinant LRRC59 protein (His tag)</p>

<p>Halofuginone Conjugate for use in immunoassays</p>

<p>Purified recombinant CCL3 protein (His tag)</p>

<p>Rat monoclonal CD24 antibody (PE)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARMCX6 antibody, catalog no. 70R-1805</p>

<p>The POU2F1 antibody is a highly specialized antibody that targets the POU2F1 protein. This protein plays a crucial role in various biological processes, including cell growth, differentiation, and development. The antibody specifically recognizes and binds to the POU2F1 protein, allowing for its detection and analysis in various experimental settings.</p>

<p>APP antibody was raised using the middle region of APP corresponding to a region with amino acids EAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAAN</p>

<p>Clenbuterol-BSA</p>

<p>Rabbit polyclonal XRCC3 antibody</p>

<p>Cacng8 antibody was raised in rabbit using the middle region of Cacng8 as the immunogen</p>

<p>Mouse monoclonal GABPB2 antibody</p>

<p>Mycoplasma pneumoniae protein is a neutralizing protein that plays a crucial role in combating infections caused by Mycoplasma pneumoniae. This protein has been extensively studied and is known for its ability to inhibit the growth of Mycoplasma pneumoniae, a common respiratory pathogen. It acts by binding to specific receptors on the surface of the bacteria, preventing their attachment and subsequent invasion of host cells.</p>

<p>XPNPEP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFS</p>

<p>LIN7C antibody was raised using a synthetic peptide corresponding to a region with amino acids MGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAV</p>

<p>Rabbit polyclonal WRKY62.2 antibody</p>

<p>Rabbit Polyclonal Vimentin antibody (Ser83)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication of bacteria. It has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, such as hydrolysis, oxidation, reduction, and conjugation. Additionally, it binds to markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.</p>

<p>ZNF200 antibody was raised in rabbit using the middle region of ZNF200 as the immunogen</p>

<p>TNFRSF10B antibody is a polyclonal antibody that specifically targets the TNFRSF10B protein. This protein is found in the nucleus and adipose tissues and plays a crucial role in various biological processes. The TNFRSF10B antibody is designed to neutralize the activity of TNFRSF10B, making it an essential tool for research in the life sciences field.</p>

<p>Recombinant Human Novel Coronavirus Spike glycoprotein(S),partial</p>

<p>SLC45A2 antibody was raised using the C terminal of SLC45A2 corresponding to a region with amino acids IGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFC</p>

<p>Recombinant Human CYP2E1 protein (His tag)</p>

<p>Purified recombinant MINA protein (His tag)</p>

<p>PSMB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLD</p>

<p>PDPN antibody was raised in mouse using recombinant human PDPN (1-206aa) purified from E. coli as the immunogen.</p>

<p>KIN antibody was raised in Rabbit using Human KIN as the immunogen</p>

<p>Affinity purified rabbit CYBB antibody</p>

<p>Rabbit polyclonal EEF1G antibody</p>

<p>The p53 antibody is a highly specialized antibody that is capable of detecting and binding to the p53 protein. This protein plays a crucial role in regulating cell growth and preventing the formation of tumors. The p53 antibody is specifically designed to target and bind to the activated form of the p53 protein, making it an invaluable tool for researchers studying cancer and other diseases.</p>

<p>Gephyrin antibody was raised using the N terminal of GPHN corresponding to a region with amino acids HDELEDLPSPPPPLSPPPTTSPHKQTEDKGVQCEEEEEEKKDSGVASTED</p>

<p>Rabbit polyclonal BSK3 antibody</p>

<p>LAT antibody is a monoclonal antibody that specifically targets amyloid plaque, which is a hallmark of various neurodegenerative diseases. It has been shown to have cytotoxic effects on amyloid-beta peptide, the main component of these plaques. LAT antibody works by binding to the amyloid-beta peptide and promoting its clearance from the brain.</p>

<p>PSP antibody was raised in mouse using recombinant human PSP (1-225aa) purified from E. coli as the immunogen.</p>

<p>Rod1 antibody was raised in rabbit using the N terminal of Rod1 as the immunogen</p>

<p>xNopp180 antibody was raised in mouse using Nucleolar fraction prepared from Xenopus laevis oocytes as the immunogen.</p>

<p>BMP4 antibody was raised in mouse using highly pure recombinant human BMP-4 as the immunogen.</p>

<p>Rabbit polyclonal RAB39B antibody</p>

<p>Purified Rabbit polyclonal PDCD10 antibody</p>

<p>Purified Rabbit polyclonal GUSBL1 antibody</p>

<p>DKFZP564O0523 antibody was raised using the C terminal of DKFZP564O0523 corresponding to a region with amino acids FLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIRHKLKEVISSVPK</p>

<p>LRRC24 antibody was raised using the N terminal of LRRC24 corresponding to a region with amino acids HLPRLQELHLQENSIELLEDQALAGLSSLALLDLSRNQLGTISREALQPL</p>

<p>The MAGE antibody is a low-molecular-weight antiviral agent that is used to detect specific proteins in blood plasma. It belongs to the class of Monoclonal Antibodies, which are highly specific antibodies produced by identical immune cells. The MAGE antibody can be used in various applications, including syncytia formation assays and detection of specific proteins in diagnostic tests.</p>

<p>Abca1 antibody was raised in rabbit using the middle region of Abca1 as the immunogen</p>

<p>The GAPDH antibody is a highly specific monoclonal antibody that targets glyceraldehyde-3-phosphate dehydrogenase (GAPDH). This antibody is widely used in life sciences research to detect and quantify GAPDH levels in various samples, including blood plasma and isolated nucleic acids.</p>

<p>Mouse Red Blood Cells are a valuable resource in various research applications. These cells play a crucial role in studying the effects of different factors on cell growth and development. Mouse Red Blood Cells contain important molecules such as dopamine, growth factors, necrosis factor-related apoptosis-inducing ligands, and chemokines that are involved in various biological processes. One of the key characteristics of Mouse Red Blood Cells is their ability to induce hemolysis. This property makes them ideal for studying the effects of different substances on cell membrane integrity and function. Additionally, Mouse Red Blood Cells have been used in veterinary applications to study the anti-vascular endothelial growth factor (anti-VEGF) activity of certain compounds. Researchers have also utilized Mouse Red Blood Cells to investigate the potential therapeutic properties of monoclonal antibodies like adalimumab. These antibodies have shown antiangiogenic effects, making them promising candidates for treating various diseases. Furthermore, Mouse Red Blood Cells can be used to study protein kinase inhibitors and their impact on</p>

<p>The FYN antibody is a monoclonal antibody that specifically targets the glial fibrillary acidic protein (GFAP). It is commonly used in research and diagnostic applications to detect and study GFAP expression. GFAP is an intermediate filament protein that is highly expressed in astrocytes, a type of glial cell in the central nervous system. The FYN antibody can be used to visualize and quantify GFAP levels in various tissues and cell types, providing valuable insights into the role of astrocytes in neurological diseases and disorders.</p>

<p>Factor X antibody is a polyclonal antibody that specifically targets Factor X, an essential protein involved in the blood clotting cascade. This antibody is derived from adeno-associated virus and has been shown to have high affinity and specificity for Factor X. It can be used in various life science applications, such as research studies on blood coagulation, as well as in the development of anti-neoplastic agents with antiangiogenic activity. Additionally, this antibody has been found to inhibit lipid peroxidation, which may have implications in preventing oxidative damage. With its unique properties and potential therapeutic applications, Factor X antibody is a valuable tool for researchers and clinicians alike.</p>

<p>AChE antibody was raised in mouse using purified human cerebellar acetylcholinesterase as the immunogen.</p>

<p>NUDC antibody was raised using a synthetic peptide corresponding to a region with amino acids DAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYR</p>

<p>The HES1 antibody is a highly specific monoclonal antibody used in Life Sciences research. It targets the HES1 protein, which plays a crucial role in various cellular processes such as cell differentiation and proliferation. This antibody is commonly utilized in studies involving collagen, alpha-fetoprotein, helicobacter, androgen, annexin, and epidermal growth factor.</p>

<p>STK38 antibody was raised using the C terminal of STK38 corresponding to a region with amino acids IGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESD</p>

<p>Claudin 19 antibody was raised using the C terminal of CLDN19 corresponding to a region with amino acids AVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREPVVKLPASAKGPLGV</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HYAL1 antibody, catalog no. 70R-9002</p>

<p>Mouse monoclonal TCP11L2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARGFX antibody, catalog no. 70R-8696</p>

<p>TRIM36 antibody was raised using the middle region of TRIM36 corresponding to a region with amino acids GYIMELIAKGKASAMGLQQTHEHSRLTSKGGEARCPFEISEVGKQSLPRR</p>

<p>The Calponin antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of Monoclonal Antibodies and is designed for use in human serum. This antibody is specifically designed to target and bind to calponin, a protein involved in various cellular processes.</p>

<p>Mouse monoclonal CD20 antibody (biotin)</p>

<p>HAV VP1 antibody is a monoclonal antibody that specifically targets the HAV VP1 protein. This antibody can be used in various applications, including immunoassays and protein detection. The HAV VP1 antibody is highly specific and exhibits strong binding affinity to the target protein, ensuring accurate and reliable results.</p>

<p>TNF alpha antibody was raised in rabbit using highly pure recombinant murine TNF-alpha as the immunogen.</p>

<p>C9ORF4 antibody was raised using the middle region of C9Orf4 corresponding to a region with amino acids HDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNVP</p>

<p>WDR55 antibody was raised using the middle region of WDR55 corresponding to a region with amino acids AKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACG</p>

<p>Rabbit polyclonal VEGFR2 antibody (Tyr1054)</p>

<p>The Histone H1 antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets and neutralizes histone H1, an important protein involved in chromatin structure and gene regulation. It has been extensively tested and validated for use in various applications, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>06:0-06:0 NBD pc is a mouse monoclonal antibody that recognizes the extracellular domain of the human protein, calcitonin receptor-like receptor (CLR). CLR is a GPCR that is activated by calcitonin and mediates Ca2+ signaling. 06:0-06:0 NBD pc has been used to study protein interactions, ion channels, and cell biology. 06:0-06:0 NBD pc has also been used as a research tool in pharmacology and life sciences.</p>

<p>EVX2 antibody was raised in rabbit using the middle region of EVX2 as the immunogen</p>

<p>PPM1K antibody was raised using a synthetic peptide corresponding to a region with amino acids AHAVTEQAIQYGTEDNSTAVVVPFGAWGKYKNSEINFSFSRSFASSGRWA</p>

<p>SLC22A12 antibody was raised using a synthetic peptide corresponding to a region with amino acids SMLENFSAAVPSHRCWAPLLDNSTAQASILGSLSPEALLAISIPPGPNQR</p>

<p>The Influenza B antibody is a hormone peptide that possesses antiviral properties. It is widely used in the field of Life Sciences to study various aspects of influenza infection. This antibody specifically targets and neutralizes the Influenza B virus, preventing its replication and spread within the body. It has been extensively studied for its ability to inhibit the activity of autoantibodies and other immune factors associated with viral infections.</p>

<p>Region of IL11 protein corresponding to amino acids MPGPPPGPPR VSPDPRAELD STVLLTRSLL ADTRQLAAQL RDKFPADGDH NLDSLPTLAM SAGALGALQL PGVLTRLRAD LLSYLRHVQW LRRAGGSSLK TLEPELGTLQ ARLDRLLRRL QLLMSRLALP QPPPDPPAPP LAPPSSAWGG IRAAHAILGG LHLTLDWAVR GLLLLKTRL.</p>

<p>Streptavidin protein is a glycoprotein commonly used in Life Sciences research. It has a high affinity for biotin, making it an ideal tool for various applications such as immunohistochemistry, Western blotting, and protein purification. Streptavidin protein is often used in conjunction with biotinylated monoclonal antibodies to detect specific biomolecules in samples.</p>

<p>Mouse monoclonal SLFNL1 antibody</p>

<p>SDCBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQ</p>

<p>Rabbit polyclonal TCP10 antibody</p>

<p>Rhodopsin antibody is a monoclonal antibody that specifically targets and binds to rhodopsin, an important protein involved in vision. This antibody has been extensively studied and shown to have a high affinity for rhodopsin, making it an effective tool for research and diagnostics. It can be used in various applications, such as immunohistochemistry, where it helps visualize the distribution and localization of rhodopsin in tissues. Additionally, this antibody has neutralizing properties, meaning it can block the activity of rhodopsin and inhibit its function. This makes it a valuable tool for studying the role of rhodopsin in various biological processes. Whether you're conducting research in Life Sciences or working on diagnostic applications, this rhodopsin antibody is a reliable choice that delivers accurate and reproducible results.</p>

<p>Mouse monoclonal CTDSP1 antibody</p>

<p>Rabbit polyclonal SAR1B antibody</p>

<p>IFN Gamma R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHL</p>

<p>Rabbit polyclonal PLCXD1 antibody</p>

<p>SMAD4 antibody was raised in Mouse using a purified recombinant fragment of human SMAD4 expressed in E. coli as the immunogen.</p>

<p>MTUS1 antibody was raised using the middle region of MTUS1 corresponding to a region with amino acids KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR</p>

<p>The Cyclin D1 antibody is a highly specialized Polyclonal Antibody used in immunoassays within the Life Sciences field. It specifically targets endothelial growth factors, such as fibronectin and collagen, to provide accurate and reliable results. This antibody is available in both polyclonal and monoclonal forms, giving researchers the flexibility to choose the best option for their experiments.</p>

<p>The NGAL antibody is a monoclonal antibody that specifically targets and binds to activated human serum. It has been extensively studied in the field of Life Sciences for its potential therapeutic applications. The NGAL antibody has shown promising results in inhibiting the activity of sclerostin, a protein involved in bone metabolism. Additionally, it has been found to bind to nuclear antigens and collagen, making it a valuable tool for research in various areas such as immunology and oncology. The NGAL antibody also exhibits cytotoxic effects, making it suitable for antibody-drug conjugate (ADC) development. With its high specificity and versatility, the NGAL antibody is an essential component in the arsenal of researchers and scientists working towards advancements in medical science.</p>

<p>Mouse monoclonal SAFB1 antibody</p>

<p>Purified recombinant RNF34 protein (His tag)</p>