Bioquímicos e reagentes

<p>Purified Rabbit polyclonal BORG1 antibody</p>

<p>Rabbit polyclonal SERPINB6 antibody</p>

<p>The GMCSF antibody is a neutralizing antibody that acts as an inhibitor in the field of Life Sciences. It targets and binds to tyrosine residues, preventing the activation of certain cellular pathways. This antibody can be used in various applications such as immunohistochemistry, where it helps visualize specific proteins or cells of interest. Additionally, the GMCSF antibody has been shown to have therapeutic potential in conditions like endotoxemia, where it can neutralize the effects of inflammatory cytokines like TNF-α. It has also been studied for its role in modulating actin dynamics and regulating cellular responses to stimuli. The GMCSF antibody is commonly used in research settings and is available as a purified form for easy use.</p>

<p>Purified Rabbit polyclonal Chk1 antibody (Ser280)</p>

<p>CDC2 antibody was raised using the middle region of Cdc2 corresponding to a region with amino acids DYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHP</p>

<p>SGLT1 antibody was raised in rabbit using a 19 amino acid peptide sequence of mouse/rabbit SGLT-1 as the immunogen.</p>

<p>FBXW7 antibody was raised using the C terminal of FBXW7 corresponding to a region with amino acids  LKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVL</p>

<p>EEF1A2 antibody was raised using the middle region of EEF1A2 corresponding to a region with amino acids VIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKP</p>

<p>MKNK2 antibody was raised using the N terminal of MKNK2 corresponding to a region with amino acids SDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGRATDSFSGRFEDVYQL</p>

<p>MLF2 antibody was raised using the middle region of MLF2 corresponding to a region with amino acids DSDSGLEQMSIGHHIRDRAHILQRSRNHRTGDQEERQDYINLDESEAAAF</p>

<p>Rabbit polyclonal SAT1 antibody (HRP)</p>

<p>Purified Rabbit polyclonal Desmin antibody (Ser60)</p>

<p>The FZD4 antibody is a highly active agent that functions as a steroid receptor. It has been extensively studied and proven to effectively modulate cortisol concentration in various experimental settings. This antibody has shown promising results in inhibiting the growth of MCF-7 cells, particularly when used in combination with trastuzumab and epidermal growth factor. Additionally, it has demonstrated its efficacy in targeting low-density lipoprotein receptors, making it a valuable tool in Life Sciences research. The FZD4 antibody also plays a crucial role in the detection and analysis of autoantibodies and serves as an essential component for the development of inhibitors and monoclonal antibodies. With its exceptional specificity and reliability, this antibody offers immense potential for advancing scientific discoveries in the field of cortisol regulation and related areas.</p>

<p>Rat monoclonal IL21R antibody (biotin)</p>

<p>ACTR3B antibody was raised using a synthetic peptide corresponding to a region with amino acids MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRR</p>

<p>TBK1 antibody was raised using the N terminal of TBK1 corresponding to a region with amino acids EEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGM</p>

<p>Mouse monoclonal C2orf56 antibody</p>

<p>The TANK antibody is a polyclonal antibody used in Life Sciences research. It specifically targets TGF-beta, epidermal growth factor, and other proteins present in human serum. This antibody has cytotoxic properties and can neutralize the effects of alpha-fetoprotein, chemokines, and growth factors. The TANK antibody can be used in various applications such as ELISA, Western blotting, immunohistochemistry, and flow cytometry. Its high affinity for its target proteins ensures accurate and reliable results in experiments. Researchers can rely on the TANK antibody to study the role of these proteins in different biological processes and diseases.</p>

<p>ETV1 antibody was raised in rabbit using the N terminal of ETV1 as the immunogen</p>

<p>The Thrombin Receptor antibody is a powerful tool for researchers in the field of Life Sciences. This antibody, available in both polyclonal and monoclonal forms, targets the thrombin receptor, which plays a crucial role in various biological processes. By binding to the receptor, this antibody can act as a receptor antagonist, blocking its signaling pathways and providing valuable insights into its function.</p>

<p>Rabbit polyclonal RAI1 antibody</p>

<p>Mouse monoclonal ANAPC2 antibody</p>

<p>Mouse monoclonal HSV2 gB antibody</p>

<p>Thiamphenicol antibody is a polyclonal antibody that acts as an inhibitor against the hormone peptide MCF-7. This antibody is widely used in Life Sciences research and has shown effectiveness in targeting antigens such as anti-CD20. It can be immobilized on electrodes for various applications, including the detection and quantification of chemokines. Additionally, this antibody can be used in the development of monoclonal antibodies and antibody-drug conjugates. Its potential therapeutic applications include targeting amyloid plaques in neurodegenerative diseases.</p>

<p>Mouse monoclonal EFNA2 antibody</p>

<p>Purified native Human Lactate Dehydrogenase 1 protein</p>

<p>Rabbit polyclonal TROVE2 antibody</p>

<p>TMEM166 antibody was raised using the N terminal Of Tmem166 corresponding to a region with amino acids RLPLSHSPEHVEMALLSNILAAYSFVSENPERAALYFVSGVCIGLVLTLA</p>

<p>Mouse monoclonal LDLRAP1 antibody</p>

<p>PPAR antibody was raised in rabbit using Synthetic Peptide: I(484) K K T E T D M S L H P L L Q(498) as the immunogen.</p>

<p>ZDHHC16 antibody was raised using the C terminal of ZDHHC16 corresponding to a region with amino acids VLISRGETSIERHINKKERRRLQAKGRVFRNPYNYGCLDNWKVFLGVDTG</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth and prevents transcription and replication. The potency of this drug has been demonstrated through patch-clamp technique on human erythrocytes. Metabolized through various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>PRR5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLDPTRSSLPRSSPENLVDQILESVDSDSEGIFIDFGRGRGSGMSDLEGS</p>

<p>Testosterone-OVA conjugate</p>

<p>Rat monoclonal CD45R antibody (allophycocyanin)</p>

<p>Purified recombinant VAV1 protein (His tag)</p>

<p>LNPEP antibody was raised in Rabbit using Human LNPEP as the immunogen</p>

<p>Mouse monoclonal LACTB2 antibody</p>

<p>Purified recombinant Human OCT4 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NRG3 antibody, catalog no. 70R-6237</p>

<p>Rabbit polyclonal RABEPK antibody</p>

<p>Mouse macrophage antibody (FITC) was raised in rabbit using mouse macrophages as the immunogen.</p>

<p>Mouse monoclonal ACY3 antibody</p>

<p>Purified recombinant NCS1 protein (His tag)</p>

<p>AKR1B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQN</p>

<p>OR10X1 antibody was raised using the middle region of OR10X1 corresponding to a region with amino acids  NIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAHP</p>

<p>Rabbit polyclonal VWA2 antibody</p>

<p>The AML1 antibody is a highly specialized Polyclonal Antibody used in immunosuppressant therapies. It is designed to target protein-protein interactions involving AML1, a transcription factor that plays a crucial role in the development of various blood cells. This antibody is derived from colloidal gold and calmodulin, ensuring its high specificity and affinity for AML1. The monoclonal nature of this antibody allows for precise targeting and binding to AML1-expressing cells.</p>

<p>Purified recombinant SSR4 protein</p>

<p>Purified recombinant TPPP3 protein (His tag)</p>

<p>POLD2 antibody was raised in mouse using recombinant Human Polymerase (Dna Directed), Delta 2, Regulatory Subunit 50Kda (Pold2)</p>

<p>Mouse monoclonal SD IpaA antibody</p>

<p>Flunixin Conjugate for use in immunoassays</p>

<p>Mouse monoclonal FBXO21 antibody</p>

<p>Rabbit polyclonal WRKY27.1 antibody</p>

<p>Rabbit polyclonal SULT2B1 antibody</p>

<p>PTGER3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>Rabbit polyclonal ABL1 antibody (Tyr412)</p>

<p>Purified Polyclonal Connexin 37 antibody</p>

<p>DPP9 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal ZCCHC11 antibody</p>

<p>NRG1 antibody was raised using the middle region of NRG1 corresponding to a region with amino acids SEVQVTVQGDKAVVSFEPSAAPTPKNRIFAFSFLPSTAPSFPSPTRNPEV</p>

<p>The SFTPD antibody is a substance that belongs to the group of antibodies. It is commonly used in gas-liquid interface studies and has been shown to have antinociceptive properties, meaning it can inhibit pain sensation. In Life Sciences, this antibody is often used as an inhibitor to study the function of specific proteins or pathways. Additionally, the SFTPD antibody has been used in research related to collagen and its role in diseases and therapeutics. It is a polyclonal antibody, meaning it recognizes multiple epitopes on its target protein. This makes it a versatile tool for various applications, including vaccine strain development and the development of new medicines.</p>

<p>Mouse monoclonal SSR2 antibody</p>

<p>The PNMT antibody is a monoclonal antibody that targets the tumor necrosis factor-alpha (TNF-α) in Life Sciences research. It can be used for various applications, including immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). This antibody specifically binds to TNF-α, a cytokine involved in inflammation and immune response regulation. By targeting TNF-α, the PNMT antibody allows researchers to study its role in different biological processes. The antibody is produced using advanced hybridization techniques and is highly specific and sensitive. It can be used in combination with other antibodies or detection reagents such as streptavidin or transferrin to enhance signal detection. The PNMT antibody is supplied with detailed protocols for optimal performance and contains no harmful excipients. With its high quality and reliability, this antibody is an indispensable tool for researchers working in the field of Life Sciences.</p>

<p>Please enquire for more information about ELP5 protein (His tag) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Carbonyl Reductase 1 antibody was raised using the middle region of CBR1 corresponding to a region with amino acids AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ</p>

<p>Legumain protein is a vital component in the field of Life Sciences. It plays a crucial role in various biological processes and has significant applications in research and development. This protein can be used for various purposes, including studying liver microsomes, developing monoclonal antibodies, and investigating the interaction between proteins and antigens.</p>

<p>LILRA4 antibody was raised in Rabbit using Human LILRA4 as the immunogen</p>

<p>Rabbit polyclonal TADA3L antibody</p>

<p>Purified recombinant PDZD11 protein (His tag)</p>

<p>GNAO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPF</p>

<p>Rabbit polyclonal GPR126 antibody</p>

<p>Mouse monoclonal ACY3 antibody</p>

<p>MAGEA8 antibody was raised in Rabbit using Human MAGEA8 as the immunogen</p>

<p>TINF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SDEEENGQGEGKESLENYQKTKFDTLIPTLCEYLPPSGHGAIPVSSCDCR</p>

<p>The IL8 antibody is a monoclonal antibody that specifically targets and binds to IL8, a growth factor involved in various biological processes. This antibody is widely used in life sciences research, particularly in bioassays and immunoassays to detect and quantify IL8 levels. It can also be used for therapeutic purposes, especially in the treatment of intraocular diseases associated with elevated IL8 levels.</p>

<p>The YAP1 antibody is a polyclonal antibody that specifically targets the YAP1 protein. This protein plays a crucial role in various cellular processes, including cell proliferation, differentiation, and apoptosis. The YAP1 antibody is designed to recognize and bind to the YAP1 protein, allowing for its detection and analysis in biological samples.</p>

<p>Rabbit polyclonal SAMM50 antibody</p>

<p>LST-3TM12 antibody was raised using the middle region of LST-3TM12 corresponding to a region with amino acids RAFFGLKVALIFPVLVLLTVFIFVVRKKSHGKDTKVLENERQVMDEANLE</p>

<p>CCDC28B antibody was raised in Rabbit using Human CCDC28B as the immunogen</p>

<p>FGL1 antibody was raised using the middle region of FGL1 corresponding to a region with amino acids EFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWL</p>

<p>Rabbit polyclonal TRMT2A antibody</p>

<p>The BRAF antibody is a powerful tool used in Life Sciences research for the detection and analysis of specific proteins. This monoclonal antibody specifically targets the BRAF protein, which plays a crucial role in cell signaling pathways and is frequently mutated in various cancers. By binding to BRAF, this antibody allows researchers to study its expression, localization, and interactions with other molecules.</p>

<p>H6PD antibody was raised using a synthetic peptide corresponding to a region with amino acids HFSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKALDGLW</p>

<p>FSH beta antibody was raised in mouse using high purity intact FSH from human pituitary gland as the immunogen.</p>

<p>Purified recombinant NT5E protein (His tag)</p>

<p>TLR6 antibody was raised using the middle region of TLR6 corresponding to a region with amino acids KCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYSKTTLKALTIEHIT</p>

<p>Mouse monoclonal CD45.1 antibody (biotin)</p>

<p>GLUT2 antibody was raised in rabbit using a 16 amino acid peptide from rat Glut-2 as the immunogen.</p>

<p>Mouse monoclonal ACAT2 antibody</p>

<p>Purified Rabbit polyclonal HIRA antibody (Thr555)</p>

<p>SEMA3D antibody was raised using the middle region of SEMA3D corresponding to a region with amino acids LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS</p>

<p>The FAM84B antibody is a monoclonal antibody that targets the FAM84B protein. This protein plays a crucial role in various biological processes, including fatty acid metabolism and cell growth. The FAM84B antibody specifically binds to the FAM84B protein, allowing for its detection and analysis in various research applications.</p>

<p>Rabbit polyclonal APP antibody (HRP)</p>

<p>USP22 antibody was raised using the N terminal of USP22 corresponding to a region with amino acids RLHSCLYCVFFGCFTKKHIHEHAKAKRHNLAIDLMYGGIYCFLCQDYIYD</p>

<p>Rabbit polyclonal SDP3 antibody (FITC)</p>

<p>Mouse monoclonal NDUFA7 antibody</p>

<p>Rabbit polyclonal MAP2K7 antibody</p>