Bioquímicos e reagentes

<p>Purified recombinant HOXC11 protein (His tag)</p>

<p>Rabbit polyclonal Caspase 1 antibody (FITC)</p>

<p>Mouse monoclonal OMP28 antibody</p>

<p>Sheep polyclonal Sulphanitran antibody</p>

<p>RPL37A antibody was raised using the middle region of RPL37A corresponding to a region with amino acids CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD</p>

<p>Mouse monoclonal DPP9 antibody</p>

<p>Rabbit polyclonal CK2A1 antibody (Tyr255)</p>

<p>MGSSHHHHHH SSGLVPRGSH MAEDADMRNE LEEMQRRADQ LADESLESTR RMLQLVEESK DAGIRTLVML DEQGEQLERI EEGMDQINKD MKEAEKNLTD LGKFCGLCVC PCNKLKSSDA YKKAWGNNQD GVVASQPARV VDEREQMAIS GGFIRRVTND ARENEMDENL EQVSGIIGNL RHMALDMGNE IDTQNRQIDR IMEKADSNKT RIDEANQRAT KMLGSG</p>

<p>The TFR2 antibody is a highly effective tool in antiestrogen therapy. It specifically targets the histamine H4 receptor, which plays a crucial role in estrogen signaling pathways. By blocking this receptor, the TFR2 antibody effectively inhibits the growth and proliferation of estrogen-dependent tumors.</p>

<p>Purified Rabbit polyclonal ACVR1B antibody</p>

<p>Purified recombinant SIAH1 protein (His tag)</p>

<p>Avilamycin Conjugate for use in immunoassays</p>

<p>Purified Rabbit polyclonal EIF2AK1 antibody</p>

<p>UBE2M antibody was raised using a synthetic peptide corresponding to a region with amino acids IKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISF</p>

<p>NDUFA9 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPY</p>

<p>The nNOS antibody is a highly effective tool in the field of atypical hemolytic research. It is specifically designed to target and detect brucella abortus, a bacterium that causes serious infections in animals and humans. This antibody belongs to the class of polyclonal antibodies, which means it can recognize multiple epitopes on the target protein.</p>

<p>Toxoplasma gondii protein is a versatile and essential component in the field of Life Sciences. This protein exhibits various characteristics that make it highly valuable for research purposes. It possesses epidermal growth factor properties, making it an excellent candidate for studying cellular growth and development. Additionally, Toxoplasma gondii protein has been found to have neutralizing effects, which can be utilized in the development of therapeutic interventions.</p>

<p>Sheep polyclonal Flunixin antibody</p>

<p>Purified recombinant PRRT2 protein (His tag)</p>

<p>Tead4 antibody was raised in rabbit using the middle region of Tead4 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MYOZ1 antibody, catalog no. 70R-2197</p>

<p>Rabbit polyclonal KLHDC2 antibody</p>

<p>Rat monoclonal CIRE antibody (biotin)</p>

<p>Cathepsin B protein is a versatile enzyme that plays a crucial role in various biological processes. It is commonly used in research and diagnostic applications. Cathepsin B protein can be easily activated using an electrode or other suitable methods. It is often used in studies involving human serum, where it helps to understand the mechanisms of certain diseases. Monoclonal antibodies specific to Cathepsin B protein are available, which enable researchers to study its functions and interactions with other proteins. Recombinant proteins of Cathepsin B are also widely used in various experiments and assays.</p>

<p>Purified recombinant LRRC59 protein (His tag)</p>

<p>Halofuginone Conjugate for use in immunoassays</p>

<p>Mouse monoclonal CP4 EPSPS antibody</p>

<p>Mouse monoclonal IRF6 antibody</p>

<p>Mouse monoclonal MHC Class I antibody (FITC)</p>

<p>Mouse brain antibody was raised in rabbit using brain tissue from BALB/c mice as the immunogen.</p>

<p>LDL receptor antibody (biotin) was raised in rabbit using a specific synthetic peptide (sequence not conserved in VLDL receptor and LRP) of the LDL receptor extracellular domain as the immunogen.</p>

<p>Leukocyte protein is a versatile and essential component of the immune system. It plays a crucial role in the body's defense against pathogens and foreign substances. This protein is involved in various processes, including antigen recognition, antibody production, and immune response regulation.</p>

<p>Purified Rabbit polyclonal CK1 alpha antibody (Thr321)</p>

<p>The HBP1 antibody is a powerful tool in the field of Life Sciences. It specifically targets epidermal growth factor and IL-17A, which are important factors in various biological processes. This antibody acts as an inhibitory factor, neutralizing the activity of these growth factors. With its high specificity and affinity, the HBP1 antibody is ideal for research purposes, such as studying cell signaling pathways and investigating the role of IL-17A in disease development. It is a polyclonal antibody produced from multiple sources, ensuring reliable and consistent results. The HBP1 antibody recognizes specific amino groups and hydroxyl groups on the target proteins, making it a valuable tool for detecting and quantifying their presence in samples. Whether you are studying leukemia inhibitory factor or interleukin-6 activation, the HBP1 antibody will provide accurate and reproducible data to advance your research.</p>

<p>Purified native Rabbit Troponin I protein (Cardiac)</p>

<p>bFGF antibody was raised in Mouse using recombinant human bFGF as the immunogen.</p>

<p>Rabbit polyclonal CDK11A antibody (HRP)</p>

<p>IgM antibody was raised in Mouse using recombinant human IgM as the immunogen.</p>

<p>LAPAQ is a hydroxyl-containing fatty acid that is synthesized by the liver and is used as a co-therapy for lowering low-density lipoprotein cholesterol. LAPAQ has been shown to have a chemical stability that is 8 times higher than that of other drugs, which may be due to its ester linkages. This drug also has anti-inflammatory properties, which are due to its ability to inhibit the production of high-sensitivity c-reactive protein (hsCRP). LAPAQ inhibits the activity of 3 enzymes involved in cholesterol synthesis, including 3-hydroxy-3-methylglutaryl coenzyme A reductase (HMG CoA reductase), acetyl coenzyme A cholesterol acyltransferase (ACAT), and lysophospholipid acyltransferase. It also inhibits the transcriptional regulation of low density lipoprotein cholesterols.</p>

<p>Purified recombinant PLAC8 protein (His tag)</p>

<p>hCG beta protein is an activated protein that plays a crucial role in various biological processes. It has been shown to induce the production of interleukin-6 (IL-6) in human serum, which is important for immune responses and inflammation regulation. In Life Sciences, hCG beta protein is used as a target antigen in DNA vaccine development and collagen research. Specific antibodies against hCG beta protein can be used for ultrasensitive detection in diagnostic assays. Additionally, hCG beta protein can be immobilized on a carbon electrode to enhance the sensitivity of electrochemical biosensors. This versatile protein is also used as a reference standard for the quantification of other proteins, such as alpha-fetoprotein. With its wide range of applications, hCG beta protein is an essential tool for researchers working with Native Proteins &amp; Antigens, DNA aptamers, and monoclonal antibodies.</p>

<p>POLK antibody was raised using a synthetic peptide corresponding to a region with amino acids ATECTLEKTDKDKFVKPLEMSHKKSFFDKKRSERKWSHQDTFKCEAVNKQ</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. Through its unique mechanism of action, this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has shown its high efficacy in human erythrocytes using a patch-clamp technique. The metabolization process involves various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed in Mycobacterium tuberculosis strains, leading to inhibition of cell growth in culture.</p>

<p>SERPIND1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVPHKMSGMKTLEAQ</p>

<p>C2ORF25 antibody was raised using the middle region of C2Orf25 corresponding to a region with amino acids RAEGYWADFIDPSSGLAFFGPYTNNTLFETDERYRHLGFSVDDLGCCKVI</p>

<p>The ERBB2 antibody is a monoclonal antibody that acts as a family kinase inhibitor. It specifically targets the epidermal growth factor receptor 2 (ERBB2), which is known to play a critical role in the growth and proliferation of cancer cells. This antibody effectively inhibits the binding of growth factors, such as epidermal growth factor and interleukin-6, to the ERBB2 receptor, thereby preventing the activation of downstream signaling pathways that promote tumor growth.</p>

<p>Mouse monoclonal JEV PreM antibody</p>

<p>Rabbit polyclonal RPC4 antibody</p>

<p>Ubiquilin 3 antibody was raised using the N terminal of UBQLN3 corresponding to a region with amino acids LMRQHVSVPEFVTQLIDDPFIPGLLSNTGLVRQLVLDNPHMQQLIQHNPE</p>

<p>The DEFB1 antibody is a growth factor and family kinase inhibitor protein that is widely used in Life Sciences research. This specific antibody is designed to bind to DEFB1, also known as human beta-defensin 1. It has been extensively validated for its high specificity and affinity towards DEFB1, making it an essential tool for studying the function and regulation of this important protein.</p>

<p>The S6 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize collagen, a protein that plays a crucial role in various biological processes. This antibody has been extensively tested and proven to be effective in inhibiting collagen's genotoxic effects.</p>

<p>Purified Polyclonal NAV3 antibody</p>

<p>Borrelia burgdorferi antibody was raised in rabbit using a whole cell preparation from Borrelia burgdorferi as the immunogen.</p>

<p>Purified recombinant RPS4X protein (His tag)</p>

<p>Rabbit polyclonal CDK7 antibody</p>

<p>Purified Polyclonal ACTN1/2/3/4 antibody</p>

<p>The CD56 antibody is a highly specialized Monoclonal Antibody that plays a crucial role in various biological processes. This antibody specifically targets the CD56 protein, which is found on the surface of human cells. CD56 antibody has been extensively studied and proven to have significant effects on immune response modulation.</p>

<p>METTL5 antibody was raised using the N terminal of METTL5 corresponding to a region with amino acids IAACMLYTIHNTYDDIENKVVADLGCGCGVLSIGTAMLGAGLCVGFDIDE</p>

<p>ASB12 antibody was raised using the C terminal of ASB12 corresponding to a region with amino acids DDKGIALLLQARATPRSLLSQVRLVVRRALCQAGQPQAINQLDIPPMLIS</p>

<p>RPSA antibody was raised using the middle region of RPSA corresponding to a region with amino acids TFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRY</p>

<p>CRABP2 antibody was raised in rabbit using the middle region of CRABP2 as the immunogen</p>

<p>Mouse monoclonal PRKCE antibody</p>

<p>Rabbit polyclonal HNRNPD antibody (FITC)</p>

<p>HDLBP antibody was raised in mouse using recombinant Human High Density Lipoprotein Binding Protein (Vigilin)</p>

<p>MAF antibody was raised in Rabbit using Human MAF as the immunogen</p>

<p>The GPI antibody is a monoclonal antibody that specifically targets β-catenin, a growth factor involved in various cellular processes. It is commonly used in research and diagnostic applications to study the role of β-catenin in different biological systems. The GPI antibody has also been found to be effective in detecting and measuring antiphospholipid antibodies, which are associated with certain autoimmune disorders. Additionally, this antibody can be used as a tool for studying the effects of caffeine on β-catenin signaling pathways. With its high specificity and affinity, the GPI antibody is a valuable tool for researchers in the field of life sciences.</p>

<p>ENPP2 antibody was raised using the N terminal of ENPP2 corresponding to a region with amino acids YTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITA</p>

<p>Purified recombinant SPSB2 protein (His tag)</p>

<p>AAV5 antibody was raised in rabbit using residues 530-541 [NSQPANPGTTATC] of 80 kDa capsid VP3 protein of AAV 5 as the immunogen.</p>

<p>Purified Polyclonal CD143 antibody</p>

<p>RNF170 antibody was raised using the middle region of RNF170 corresponding to a region with amino acids CIIAYWRYGSWLGAISCPICRQTVTLLLTVFGEDDQSQDVLRLHQDINDY</p>

<p>Rabbit polyclonal IFN beta antibody (FITC)</p>

<p>FFAR2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal ITGA4 antibody</p>

<p>SUPV3L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QGPSADGDVGAELTRPLDKNEVKKVLDKFYKRKEIQKLGADYGLDARLFH</p>

<p>Recombinant Human EEF2K protein</p>

<p>Sheep polyclonal Estriol 6a antibody</p>

<p>PCDHGC3 antibody was raised using the C terminal of PCDHGC3 corresponding to a region with amino acids IKDNGEPSLSTTATLTVSVTEDSPEARAEFPSGSAPREQKKNLTFYLLLS</p>

<p>Purified recombinant EPO1L protein (His tag)</p>

<p>Escitalopram Conjugate for use in immunoassays</p>

<p>Mouse monoclonal HIBCH antibody</p>

<p>PSMB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQ</p>

<p>Endostatin antibody was raised in Mouse using recombinant endostatin as the immunogen.</p>

<p>CA 19-9 antibody was raised in mouse using purified CA 19-9 as the immunogen.</p>

<p>Mouse monoclonal BPTF antibody</p>

<p>Mouse monoclonal EPN2 antibody</p>

<p>The MCL1 antibody is a monoclonal antibody that targets the MCL1 protein. This protein is involved in cell survival and has been implicated in various diseases, including cancer. The MCL1 antibody specifically binds to the MCL1 protein, preventing its interaction with other proteins and inhibiting its function. This can lead to decreased cell survival and increased sensitivity to chemotherapy or other treatments. Additionally, the MCL1 antibody has been shown to have anti-inflammatory properties and may play a role in immune regulation. Overall, the MCL1 antibody is a valuable tool for researchers in the field of life sciences and has potential applications in cancer treatment and other therapeutic interventions.</p>

<p>MST1R antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. This medication is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. It works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. The remarkable potency of this drug has been demonstrated through various scientific techniques like the patch-clamp technique on human erythrocytes. Additionally, it undergoes several metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture</p>

<p>Rabbit polyclonal OR5AU1 antibody</p>

<p>Rat monoclonal CD71 antibody (FITC)</p>

<p>The PDF antibody is a highly specialized molecule drug used in the field of Life Sciences. It is an activated antibody that acts as an anticoagulant, inhibiting the clotting process. This unique antibody has the ability to neutralize various molecules involved in blood coagulation, such as insulin, albumin, and fibrinogen. The PDF antibody is a monoclonal antibody, meaning it is derived from a single clone of cells and exhibits high specificity for its target. In human serum, this antibody has shown remarkable efficacy in inhibiting protein kinase activity, making it a valuable tool for research and therapeutic applications in the field of Life Sciences.</p>

<p>Purified recombinant SLA2 protein (His tag)</p>

<p>Rat monoclonal CD18 antibody (FITC)</p>

<p>Rabbit polyclonal PKCB antibody (Ser661)</p>

<p>RBMS2 antibody was raised using the N terminal of RBMS2 corresponding to a region with amino acids MLLSVTSRPGISTFGYNRNNKKPYVSLAQQMAPPSPSNSTPNSSSGSNGN</p>

<p>Purified Polyclonal MNAT1 antibody</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>Mouse monoclonal DNAJA2 antibody</p>

<p>CYP2A6 antibody was raised in rabbit using purified, histidine-tagged, full length human P450 2A6 fusion protein as the immunogen.</p>