Bioquímicos e reagentes

<p>ECD antibody was raised in Rabbit using Human ECD as the immunogen</p>

<p>The CD115 antibody is a powerful tool in Life Sciences research. It specifically targets the tyrosine kinase receptor CD115 and has been extensively used to study its role in various cellular processes. This antibody is commonly used in chemokine research, as it allows for the detection and analysis of chemokine-mediated signaling pathways. Additionally, the CD115 antibody has been utilized in the development of therapeutic antibodies, such as trastuzumab, which target specific cancer cells.</p>

<p>Purified recombinant Human BPIFA1 protein (His tag)</p>

<p>HSP90AB1 antibody was raised in rabbit using the N terminal of HSP90AB1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX19A antibody, catalog no. 70R-1339</p>

<p>Trimeprazine Tartrate (USP grade powder) chemical reference substance</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF419A antibody, catalog no. 20R-1223</p>

<p>RAB40B antibody was raised using the middle region of RAB40B corresponding to a region with amino acids YAERLGVTFFEVSPLCNFNITESFTELARIVLLRHGMDRLWRPSKVLSLQ</p>

<p>Mouse monoclonal LASS2 antibody</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>Purified recombinant Human GCLM protein (His tag)</p>

<p>OAS2 antibody was raised using the middle region of OAS2 corresponding to a region with amino acids AKGTALKTGSDADLVVFHNSLKSYTSQKNERHKIVKEIHEQLKAFWREKE</p>

<p>UBE2N antibody was raised using a synthetic peptide corresponding to a region with amino acids VDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQW</p>

<p>CUL1 antibody was raised in Rabbit using Human CUL1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF708 antibody, catalog no. 70R-8962</p>

<p>The NEU2 antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody has been specifically designed to neutralize the toxic effects of alpha-fetoprotein (AFP) in human serum. By binding to AFP, the NEU2 antibody prevents its interaction with cell surface receptors and inhibits its downstream signaling pathways. This inhibition leads to a decrease in the production of colony-stimulating factors and other growth factors that are essential for tumor growth and metastasis.</p>

<p>NR6A1 antibody was raised using the N terminal of NR6A1 corresponding to a region with amino acids MERDEPPPSGGGGGGGSAGFLEPPAALPPPPRNGFCQDELAELDPGTNDR</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPIB antibody, catalog no. 70R-1864</p>

<p>alpha 2 Antiplasmin antibody was raised in sheep using human alpha 2 Antiplasmin purified from plasma as the immunogen.</p>

<p>Recombinant human LAT protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Slc25a27 antibody, catalog no. 70R-8578</p>

<p>The PAK1 antibody is a highly specialized monoclonal antibody that targets the P21-activated kinase 1 (PAK1) protein. This antibody has been extensively studied in the field of life sciences and has shown promising results in various applications. It specifically binds to PAK1, inhibiting its activity and preventing downstream signaling pathways.</p>

<p>The RCC1 antibody is a serum marker that is used in various assays and research in the field of Life Sciences. It is a monoclonal antibody that specifically targets RCC1, an important protein involved in cell cycle regulation. This antibody can be used to detect the presence of RCC1 in biological samples, making it a valuable tool for studying its expression and function. Additionally, the RCC1 antibody has been shown to have potential therapeutic applications, as it can be used to develop targeted medicines against diseases associated with abnormal RCC1 levels. With its high specificity and sensitivity, this antibody is widely used by researchers and scientists in their studies on sirtuins, interleukins, carnitine metabolism, and antiviral mechanisms.</p>

<p>CD70 antibody was raised in rabbit using the N terminal of CD70 as the immunogen</p>

<p>Beta 2 Microglobulin Monoclonal Antibody</p>

<p>TYR antibody was raised using a synthetic peptide corresponding to a region with amino acids CLSLTQYESGSMDKAANFSFRNTLEGFASPLTGIADASQSSMHNALHIYM</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CA5B antibody, catalog no. 70R-4459</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCTD6 antibody, catalog no. 70R-1490</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AGK antibody, catalog no. 70R-3532</p>

<p>VPS37C antibody was raised using a synthetic peptide corresponding to a region with amino acids LQLEREMALATNRSLAERNLEFQGPLEISRSNLSDRYQELRKLVERCQEQ</p>

<p>ACADL antibody was raised using the middle region of ACADL corresponding to a region with amino acids LPQERLLIADVAISASEFMFEETRNYVKQRKAFGKTVAHLQTVQHKLAEL</p>

<p>HMGN4 antibody was raised in Rabbit using Human HMGN4 as the immunogen</p>

<p>WDSUB1 antibody was raised in rabbit using the middle region of WDSUB1 as the immunogen</p>

<p>Fibronectin antibody was raised in rabbit using fibronectin purified from human plasma as the immunogen.</p>

<p>IL8 antibody was raised in Mouse using a purified recombinant fragment of human IL-8 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal PSMG2 antibody</p>

<p>LSS antibody was raised in Rabbit using Human LSS as the immunogen</p>

<p>Rabbit polyclonal PKC theta antibody (Tyr313)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BEST3 antibody, catalog no. 70R-5135</p>

<p>SCAMP3 antibody was raised in rabbit using the N terminal of SCAMP3 as the immunogen</p>

<p>NET1 antibody was raised in Rabbit using Human NET1 as the immunogen</p>

<p>Rabbit polyclonal STAT4 antibody (Tyr693)</p>

<p>SLCO6A1 antibody was raised using the C terminal of SLCO6A1 corresponding to a region with amino acids LAMTRVVPDKLRSLALGVSYVILRIFGTIPGPSIFKMSGETSCILRDVNK</p>

<p>Matrin 3 antibody was raised using the N terminal of MATR3 corresponding to a region with amino acids MSKSFQQSSLSRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRMNQGTA</p>

<p>C1QTNF4 antibody was raised using the middle region of C1QTNF4 corresponding to a region with amino acids RRGDAVWLLSHDHDGYGAYSNHGKYITFSGFLVYPDLAPAAPPGLGASEL</p>

<p>Rabbit polyclonal PCDH11Y antibody</p>

<p>Mouse monoclonal PIK3AP1 antibody</p>

<p>Rabbit polyclonal RAB23 antibody</p>

<p>Mouse monoclonal Ly108 antibody (biotin)</p>

<p>The HDAC10 antibody is a growth factor that belongs to the class of Monoclonal Antibodies. It acts as a protein kinase inhibitor and exhibits antiangiogenic properties. This antibody specifically targets epidermal growth factor (EGF) and inhibits its activity. It has been shown to block the activation of the EGF receptor, preventing downstream signaling pathways involved in cell proliferation and survival. The HDAC10 antibody can also bind to erythropoietin (EPO) and inhibit its cytotoxic effects. This monoclonal antibody is widely used in Life Sciences research for studying the role of EGF and EPO in various cellular processes. Its specificity and high affinity make it an excellent tool for investigating the mechanisms of action of growth factors and their receptors.</p>

<p>CD4 antibody (Spectral Red) was raised in rat using cloned murine CTL line V4 as the immunogen.</p>

<p>The GLO1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to the glyoxalase 1 enzyme, which plays a crucial role in detoxifying harmful reactive carbonyl compounds. This antibody has been extensively studied for its potential antiviral properties and has shown promising results in inhibiting viral replication.</p>

<p>PRAC antibody was raised in rabbit using human PRAC protein as the immunogen.</p>

<p>HGD antibody was raised in Rabbit using Human HGD as the immunogen</p>

<p>Factor P antibody was raised in goat using highly purified human complement protein as the immunogen.</p>

<p>ARHGEF10 antibody was raised in Rabbit using Human ARHGEF10 as the immunogen</p>

<p>Mouse monoclonal PDE2A antibody</p>

<p>Mouse monoclonal ITFG2 antibody</p>

<p>CIDE3 antibody was raised in rabbit using residues 10-25 [LLYPKSLSRHVSVRTS] of the 27 kDa human CIDE-3 protein as the immunogen.</p>

<p>Purified Polyclonal RAD1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PIP5KL1 antibody, catalog no. 70R-2043</p>

<p>The MTH1 antibody is a growth factor that plays a crucial role in various biological processes. It acts as a neutralizing agent against chemokines, helicobacter proteins, and TGF-beta. This monoclonal antibody is widely used in the field of Life Sciences for its ability to target specific molecules and inhibit their activity. Additionally, the MTH1 antibody has been shown to have therapeutic potential when combined with other drugs such as olaparib. It can also be used as a research tool for studying phosphatase activity, ferritin levels, interleukin-6 signaling, collagen synthesis, and immobilization processes. With its versatility and specificity, the MTH1 antibody is an essential tool for researchers in various fields.</p>

<p>The LECT2 antibody is a highly specific monoclonal antibody that has been developed for use in the field of Life Sciences. It is designed to target and bind to LECT2 (leukocyte cell-derived chemotaxin 2), a protein found in human serum. This antibody can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NANP antibody, catalog no. 70R-4175</p>

<p>BASP1 antibody was raised in rabbit using the N terminal of BASP1 as the immunogen</p>

<p>Purified recombinant Human PTGR1 protein (His tag)</p>

<p>HIV1 gp120 antibody (biotin) was raised in goat using purified native gp120 from strain IIIB as the immunogen.</p>

<p>ADSSL1 antibody was raised using the middle region of ADSSL1 corresponding to a region with amino acids VDGLQEVQRQAQEGKNIGTTKKGIGPTYSSKAARTGLRICDLLSDFDEFS</p>

<p>Rabbit polyclonal PIK3CB antibody</p>

<p>The TFE3 antibody is a polyclonal antibody that specifically targets the beta-hairpin region of the TFE3 protein. This antibody is widely used in life sciences research, particularly in assays related to growth factors, insulin, and inhibitors. The TFE3 antibody has been shown to effectively detect and neutralize superoxide, making it a valuable tool for studying oxidative stress-related processes. Additionally, this antibody has demonstrated cytotoxic effects against cancer cells expressing high levels of c-myc and endothelial growth factors. Researchers also utilize the TFE3 antibody in anti-VEGF and erythropoietin studies. With its versatility and reliability, the TFE3 antibody is an essential component for various experiments in the field of life sciences.</p>

<p>SLC25A16 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSHAPTLLGRPSSDNPNVLVLKTHVNLLCGGVAGAIAQTISYPFDVTRRR</p>

<p>The CLDN19 antibody is a glycation-specific polyclonal antibody that targets fatty acids. It is designed to bind to specific interleukin-6 receptors and promote endocytic uptake of growth factors. This antibody can be used in various life science applications, including research and diagnostics. It exhibits high specificity and affinity for its target, making it an ideal tool for studying the role of interleukin-6 in cellular processes. Additionally, monoclonal antibodies derived from the CLDN19 antibody have been shown to have neutralizing effects on interferon activity and collagen synthesis. With its unique properties and wide range of applications, the CLDN19 antibody is a valuable asset in the field of Life Sciences.</p>

<p>EMID2 antibody was raised using the C terminal of EMID2 corresponding to a region with amino acids GVQQLREALKILAERVLILEHMIGIHDPLASPEGGSGQDAALRANLKMKR</p>

<p>FBXO24 antibody was raised using the middle region of FBXO24 corresponding to a region with amino acids EGKIYSLVVNETQLDQPRSYTVQLALRKVSHYLPHLRVACMTSNQSSTLY</p>

<p>Rabbit Polyclonal OPRM1 antibody</p>

<p>Mouse monoclonal ELK3 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its effectiveness has been demonstrated through patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Rabbit polyclonal IRAK1 antibody (Thr209)</p>

<p>NAGK antibody was raised in Rabbit using Human NAGK as the immunogen</p>

<p>Rat monoclonal CD4 antibody (FITC); mouse target; IgG2b kappa; clone GK1.5</p>

<p>MYLK2 antibody was raised in Rabbit using Human MYLK2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATP6V1B2 antibody, catalog no. 70R-2506</p>

<p>RAE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEE</p>

<p>CKBB antibody was raised in mouse using human Brain CKBB as the immunogen.</p>

<p>The PCIP antibody is a reactive monoclonal antibody that specifically targets icariin, a compound found in Life Sciences. This antibody is derived from a hybridoma cell line and is produced by fusing bovine γ-globulin with chimeric proteins. The PCIP antibody has a high affinity for icariin and can be used in various applications, including immunohistochemistry, western blotting, and ELISA assays. It recognizes both the carboxyl-terminal and amino-terminal regions of icariin, making it an excellent tool for studying the structure and function of this compound. Additionally, the PCIP antibody can be conjugated with streptavidin for enhanced detection and visualization of icariin in biological samples. With its specificity and versatility, the PCIP antibody is an invaluable resource for researchers in the field of Life Sciences.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RNF168 antibody, catalog no. 70R-2817</p>

<p>HEY1 antibody was raised using the N terminal of HEY1 corresponding to a region with amino acids ALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQG</p>

<p>VPS53 antibody was raised using a synthetic peptide corresponding to a region with amino acids VYIESQDKNLGELIDRFVADFKAQGPPKPNTDEGGAVLPSCADLFVYYKK</p>

<p>CD81 antibody (Azide free) was raised in Hamster using Mouse epithelial cell line PAM212 as the immunogen.</p>

<p>ALDH3A1 antibody was raised in Rabbit using Human ALDH3A1 as the immunogen</p>

<p>Highly purified Mouse IgG (H + L) for use as a control or blocking reagent</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, thereby inhibiting transcription and replication in the bacteria. Its effectiveness has been demonstrated through rigorous testing using the patch-clamp technique on human erythrocytes. The compound undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.</p>

<p>Mouse monoclonal ASCC1 antibody</p>

<p>Thrombomodulin protein is a crucial component in the regulation of blood clotting. It acts as a cofactor for thrombin, an enzyme involved in the conversion of fibrinogen to fibrin, which forms blood clots. Thrombomodulin protein also has anti-inflammatory properties and plays a role in endothelial cell growth and angiogenesis.</p>

<p>APOM protein is a glycation product that has been shown to have various biological activities. It has been found to induce hemolysis in red blood cells and stimulate the growth of endothelial cells. APOM protein also interacts with TNF-α, a pro-inflammatory cytokine, and acts as a growth factor for certain cell types. In addition, it has been shown to bind chemokines and oncostatin, suggesting its involvement in immune responses. APOM protein has anti-VEGF (vascular endothelial growth factor) activity and may play a role in inhibiting angiogenesis. This recombinant protein is produced using advanced techniques in Life Sciences and is formulated with excipients to ensure stability and efficacy. It can be used in research studies involving interferon or other neutralizing agents.</p>

<p>Bradykinin Receptor B2 antibody was raised using the N terminal of BDKRB2 corresponding to a region with amino acids MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQV</p>

<p>Goat anti Rabbit IgG (H + L) secondary antibody (FITC)</p>

<p>The RBBP7 antibody is a highly specialized product used in the field of Life Sciences. It plays a crucial role as a heparin cofactor, facilitating the binding and activation of various enzymes involved in important biological processes. This antibody specifically targets certain acid residues, allowing for precise assays and measurements in research and diagnostic settings.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RRP9 antibody, catalog no. 70R-1341</p>

<p>CD14 antibody was raised in Mouse using a purified recombinant fragment of human CD14 expressed in E. coli as the immunogen.</p>