Bioquímicos e reagentes

<p>C6ORF146 antibody was raised using the middle region of C6Orf146 corresponding to a region with amino acids ETLPAPNWNLKHGNSSVEENFTDESDLSENEKTNDTLLSYFKKVDLNLKP</p>

<p>Sheep polyclonal Dicloxacillin antibody</p>

<p>Purified Rabbit polyclonal CNGB1 antibody</p>

<p>Keratin K20 antibody was raised in mouse using electrophoretically purified keratin K20 from human intestinal mucosa as the immunogen.</p>

<p>Rabbit polyclonal SCAMP3 antibody (biotin)</p>

<p>DAG1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVPGKPTVTIRT</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>Mouse monoclonal NLN antibody</p>

<p>Purified recombinant SET protein (His tag)</p>

<p>RRBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TDVAQSPEAPKQEAPAKKKSGSKKKGPPDADGPLYLPYKTLVSTVGSMVF</p>

<p>Rabbit polyclonal p53 antibody (HRP)</p>

<p>Mouse monoclonal LDHB antibody</p>

<p>Rabbit polyclonal Catenin beta antibody (Tyr489)</p>

<p>Mouse monoclonal ZFAND2B antibody</p>

<p>MYH10 antibody was raised using the N terminal of MYH10 corresponding to a region with amino acids WFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKAD</p>

<p>The ST7 antibody is a highly specialized product used in the field of Life Sciences. It is an essential tool for researchers and scientists studying epidermal growth factor and its role in various biological processes. This antibody has been extensively tested and validated using electrochemical impedance spectroscopy, ensuring its accuracy and reliability.</p>

<p>PLK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRLKAS</p>

<p>TNFR1 antibody is a highly effective monoclonal antibody that specifically targets and binds to the TNFR1 protein. This colloidal antibody has been extensively studied in various life science research applications. It has shown great potential in the field of immunology, particularly in studying the role of TNFR1 in inflammatory responses.</p>

<p>The FABP monoclonal antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets and neutralizes fatty acid-binding protein (FABP), which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively studied for its cytotoxic effects on cells expressing FABP, making it a valuable tool for research and therapeutic applications.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MTA3 antibody, catalog no. 70R-8740</p>

<p>SRPRB antibody was raised using the C terminal of SRPRB corresponding to a region with amino acids APAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKI</p>

<p>ATP6V0D2 antibody was raised using the middle region of ATP6V0D2 corresponding to a region with amino acids GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM</p>

<p>ERAL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KVHTTRCQALGVITEKETQVILLDTPGIISPGKQKRHHLELSLLEDPWKS</p>

<p>The CD44 antibody is a specific monoclonal antibody that targets the cell-extracellular matrix interaction. It is widely used in Life Sciences research for its ability to detect and analyze activated or reactive cells. This antibody can be used in various applications, including flow cytometry, immunohistochemistry, and Western blotting. The CD44 antibody recognizes a surface glycoprotein called CD44, which plays a crucial role in cell adhesion, migration, and signaling. By binding to CD44, this antibody can help researchers study the function of this important biomolecule and its involvement in various cellular processes. Additionally, the CD44 antibody has been shown to have cytotoxic effects on certain types of cancer cells, making it a promising tool for targeted therapy.</p>

<p>Rat monoclonal OCT3/4 antibody</p>

<p>ELF2 antibody was raised in mouse using recombinant Human E74-Like Factor 2 (Ets Domain Transcription Factor) (Elf2)</p>

<p>Rabbit polyclonal S100A1 antibody</p>

<p>MPPE1 antibody was raised using the N terminal of MPPE1 corresponding to a region with amino acids WLLQPEVVFILGDIFDEGKWSTPEAWADDVERFQKMFRHPSHVQLKVVAG</p>

<p>FBXW8 antibody was raised using the middle region of FBXW8 corresponding to a region with amino acids MNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHR</p>

<p>Mouse monoclonal RASSF5 antibody</p>

<p>Mouse monoclonal JMJD6 antibody (N-terminus)</p>

<p>UBTD1 antibody was raised in rabbit using the middle region of UBTD1 as the immunogen</p>

<p>Rabbit polyclonal EGFR antibody (Tyr1016)</p>

<p>Normal Chicken Serum is a versatile biospecimen that can be used in various life science and veterinary applications. It contains a rich mixture of proteins, growth factors, and antibodies that are naturally present in chicken blood. This serum is commonly used as a control or reference sample in experiments involving liver microsomes, dopamine, TGF-beta, interleukin-6, teriparatide, epidermal growth factor, and other biomolecules.</p>

<p>Colestipol HCL (USP grade powder) chemical reference substance</p>

<p>Rabbit polyclonal RASA1 antibody</p>

<p>Purified native Human Alpha 1 Acid Glycoprotein protein</p>

<p>Rabbit polyclonal PDE4D antibody (Ser190/53)</p>

<p>Rat monoclonal Mac3 antibody (FITC)</p>

<p>Recombinant Human GDF11 protein (His tag)</p>

<p>The SOX13 antibody is a vasoactive intestinal peptide (VIP) neutralizing monoclonal antibody. It is a low-molecular-weight antibody that has been shown to effectively neutralize VIP in human serum. This monoclonal antibody can also target autoantibodies and has neuroprotective properties. Studies have demonstrated that the SOX13 antibody can protect against neurodegenerative diseases and reduce inflammation. Additionally, it has been found to enhance the effects of ketamine and interferon therapy. The electrode immobilization technique can be used to deliver the SOX13 antibody directly to target cells for optimal therapeutic results. If you are looking for high-quality antibodies for life sciences research, the SOX13 antibody is an excellent choice.</p>

<p>H2AFY2 antibody was raised using the middle region of H2AFY2 corresponding to a region with amino acids PRIHPELLAKKRGTKGKSETILSPPPEKRGRKATSGKKGGKKSKAAKPRT</p>

<p>Purified Rabbit polyclonal RNPK antibody (Ser284)</p>

<p>HOXA5 antibody was raised in rabbit using the C terminal of HOXA5 as the immunogen</p>

<p>The Chloramphenicol antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to chloramphenicol, a medicament commonly used as an anticoagulant in medical treatments. This antibody is capable of recognizing and binding to the molecule drug with high affinity and specificity.</p>

<p>RANTES antibody was raised in rabbit using highly pure recombinant rat RANTES as the immunogen.</p>

<p>Mouse monoclonal DUSP23 antibody</p>

<p>The BTN1A1 antibody is a highly effective neutralizing agent that targets the c-myc antigen. This monoclonal antibody is widely used in Life Sciences research and has been proven to have significant therapeutic potential. It specifically binds to BTN1A1, a protein involved in the regulation of low-density lipoprotein (LDL) metabolism. By targeting this protein, the BTN1A1 antibody can effectively modulate LDL levels and potentially serve as a medicament for various cardiovascular disorders.</p>

<p>Rabbit polyclonal DNAL4 antibody</p>

<p>Rabbit polyclonal XIAP antibody (Ser87)</p>

<p>Mouse monoclonal FSHB antibody</p>

<p>The EGFR antibody is a highly specialized antibody that targets the epidermal growth factor receptor (EGFR). It has been extensively studied and proven to be effective in various research fields. This antibody specifically binds to the nuclear region of cells and can be used for immunohistochemistry and immunofluorescence experiments. The EGFR antibody has been tested and validated for its specificity, ensuring accurate and reliable results.</p>

<p>SLC25A16 antibody was raised using the N terminal of SLC25A16 corresponding to a region with amino acids KTTVAPLDRVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMM</p>

<p>Neuropilin antibody was raised using the N terminal of NETO2 corresponding to a region with amino acids ELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQME</p>

<p>WARS2 antibody was raised using the middle region of WARS2 corresponding to a region with amino acids TTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQG</p>

<p>VPS54 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYLPQISKEHFTVYQQEISQREKIHERCKNICPPKDTFERTLLHTHDKSR</p>

<p>Mouse monoclonal Plakophilin 3 antibody</p>

<p>1-91 amino acids: MGSSHHHHHH SSGLVPRGSH MSAPAQPPAE GTEGTAPGGG PPGPPPNMTS NRRLQQTQAQ VEEVVDIIRV NVDKVLERDQ KLSELDDRAD ALQAGASQFE SSAAKLKRKY W</p>

<p>Purified recombinant CD300A protein (His tag)</p>

<p>RHOD antibody was raised using the N terminal of RHOD corresponding to a region with amino acids TAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVF</p>

<p>Purified recombinant KLK10 protein (His tag)</p>

<p>Mouse monoclonal NGAL antibody (Biotin)</p>

<p>HKR1 antibody was raised in rabbit using the C terminal of HKR1 as the immunogen</p>

<p>TIGD4 antibody was raised using the N terminal of TIGD4 corresponding to a region with amino acids RFDPKRKRLRTAFYTDLEEALMRWYRIAQCLNVPVNGPMLRLKANDFAQK</p>

<p>DHX9 antibody was raised in mouse using recombinant Human Deah (Asp-Glu-Ala-His) Box Polypeptide 9 (Dhx9)</p>

<p>Angiopoietin 1 antibody was raised in rabbit using a synthetic peptide corresponding to a region near the N-terminus of mouse angiopoietin 1 protein conjugated to KLH as the immunogen.</p>

<p>EPHB4 antibody was raised in Mouse using a purified recombinant fragment of EphB4 (aa562-612)expressed in E. coli as the immunogen.</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>The VEGFR2 antibody is a polyclonal antibody that specifically targets the vascular endothelial growth factor receptor 2 (VEGFR2). This receptor plays a crucial role in angiogenesis, which is the formation of new blood vessels. The VEGFR2 antibody binds to VEGFR2 and inhibits its interaction with growth factors, thereby preventing the activation of downstream signaling pathways involved in blood vessel formation.</p>

<p>The DSG2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to a specific antigen, which plays a crucial role in cell growth and development. This antibody has been extensively tested and proven to be effective in inhibiting the activity of growth factors, thereby preventing the proliferation of certain cells.</p>

<p>MAP4K1 antibody was raised using the N terminal of MAP4K1 corresponding to a region with amino acids VHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATK</p>

<p>HIRIP3 antibody was raised in mouse using recombinant Human Hira Interacting Protein 3</p>

<p>Mouse monoclonal FOSL1 antibody</p>

<p>The SOCS3 antibody is a monoclonal antibody used in Life Sciences research. It is specifically designed to neutralize the effects of tumor necrosis factor-alpha (TNF-α) and interferon-gamma (IFN-γ). This antibody is highly specific and has been extensively tested for its efficacy and reliability. The SOCS3 antibody can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. It is supplied with all necessary excipients and can be easily conjugated to streptavidin or other molecules for specific hybridization. This antibody has shown promising results in inhibiting the growth factors associated with certain diseases, making it a valuable tool for researchers studying cytokine signaling pathways.</p>

<p>Rabbit Polyclonal RCAN1 antibody</p>

<p>The ANGPTL7 protein is a growth factor that plays a crucial role in various biological processes. It has been extensively studied for its potential therapeutic applications in the field of life sciences. Teriparatide, a steroid, has shown to interact with ANGPTL7 and modulate its activity. Binding proteins and monoclonal antibodies have been developed to specifically target ANGPTL7 and neutralize its effects.</p>

<p>CBLN4 antibody was raised using the C terminal of CBLN4 corresponding to a region with amino acids HVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDK</p>

<p>CER5-2′R(d9) is an ion channel ligand that is a high-affinity antagonist of the nicotinic acetylcholine receptor. It blocks the nicotinic acetylcholine receptor by binding to the extracellular domain of the receptor, preventing it from opening. CER5-2′R(d9) has been shown to be a potent inhibitor of protein interactions with its ability to inhibit antibody binding, peptide binding, and cell biology studies.</p>

<p>The BIN3 antibody is a powerful tool in the field of life sciences. It is a monoclonal antibody that specifically targets adipose triglyceride lipase (ATGL), a key enzyme involved in lipid metabolism. This antibody has been extensively studied for its potential therapeutic applications, as well as its role in understanding the mechanisms of obesity and related metabolic disorders.</p>

<p>SAE1 antibody was raised using the N terminal of SAE1 corresponding to a region with amino acids VTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPE</p>

<p>ATG10 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP</p>

<p>Rabbit polyclonal DAPP1 antibody (Tyr139)</p>

<p>FBG2 antibody was raised in rabbit using residues 268-284 (SEAQPGQKHGQEEAAQS) of the human FBG2 protein as the immunogen.</p>

<p>UBE2C antibody was raised using the middle region of UBE2C corresponding to a region with amino acids QGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNP</p>

<p>IKZF3 antibody was raised in Rabbit using Human IKZF3 as the immunogen</p>

<p>Purified Polyclonal GNL1 antibody</p>

<p>Mouse anti Human IgG4 pFC antibody - HRP conjugate</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EVX2 antibody, catalog no. 70R-9601</p>

<p>Rabbit polyclonal SLC19A3 antibody</p>

<p>Rabbit polyclonal OLFML2B antibody</p>

<p>Triiodothyronine antibody was raised in mouse using triiodothyronine-BSA as the immunogen.</p>

<p>Rabbit polyclonal PDGFRa antibody (Tyr849)</p>

<p>MKL1 antibody was raised in rabbit using the C terminal of MKL1 as the immunogen</p>

<p>The Collagen Type IV antibody is a powerful tool in the field of Life Sciences. Produced by hybridoma cells, this antibody specifically targets collagen, a vital component of connective tissues. It has been shown to have inhibitory effects on helicobacter growth and can be used to detect autoantibodies in various diseases. Additionally, the Collagen Type IV antibody can be utilized as a substrate for siRNA delivery or as an anti-connexin agent. With its high specificity and affinity, this monoclonal antibody is widely used in research laboratories for studying endothelial growth and the role of collagen in various biological processes.</p>

<p>TNFSF12 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the TNFSF12 molecule, which is involved in various biological processes such as cell growth, differentiation, and immune response. This antibody has been extensively studied and shown to effectively block the activity of TNFSF12, thereby modulating its downstream effects.</p>

<p>Rabbit polyclonal CBX6 antibody</p>

<p>BMP7 antibody was raised in rabbit using highly pure recombinant human BMP-7 as the immunogen.</p>

<p>Purified Polyclonal GUCY1B3 antibody</p>

<p>Mouse anti-goat IgG (H + L) (HRP) was raised in mouse using goat IgG (H &amp; L) as the immunogen.</p>

<p>Rabbit polyclonal GPR27 antibody</p>