Bioquímicos e reagentes

<p>IL1b antibody was raised in rabbit using recombinant human IL-1b as the immunogen.</p>

<p>GAMT antibody was raised using the N terminal of GAMT corresponding to a region with amino acids MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYM</p>

<p>ZNF417 antibody was raised in rabbit using the N terminal of ZNF417 as the immunogen</p>

<p>Mouse IgG Control is a highly reliable and versatile monoclonal antibody that is widely used in various research applications. It serves as an important control for experiments involving mucin, polyclonal antibodies, protein, ferritin, and other activated monoclonal antibodies. This control antibody allows researchers to accurately assess the specificity and efficacy of their experimental procedures.</p>

<p>The Syntaxin 1A antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets and neutralizes Syntaxin 1A, a glycoprotein involved in various cellular processes. It has been extensively used in research to study the role of Syntaxin 1A in chemokine signaling, collagen synthesis, and cytotoxicity. The monoclonal antibody effectively inhibits the activity of Syntaxin 1A, allowing researchers to investigate its impact on important pathways such as growth factor signaling, interferon response, and hepatocyte growth. With its high specificity and potency, the Syntaxin 1A antibody is an invaluable resource for scientists looking to unravel the complex mechanisms underlying cellular functions.</p>

<p>Purified recombinant Human CD300C protein (His tag)</p>

<p>IL18BP antibody was raised in goat using highly pure recombinant murine IL-18BP as the immunogen.</p>

<p>The GPR15 antibody is an active agent in the field of Life Sciences. It specifically targets a molecule called cortisol, which plays a crucial role in various physiological processes. This antibody has been shown to bind to cortisol with high affinity, allowing for the detection and measurement of cortisol levels in biological samples.</p>

<p>Rabbit polyclonal STK38L antibody</p>

<p>Mouse monoclonal HARS2 antibody</p>

<p>Purified recombinant TRAPPC4 protein</p>

<p>The LGALS3BP antibody is a monoclonal antibody that has been developed for use in various applications within the field of Life Sciences. It specifically targets LGALS3BP, a protein involved in multiple cellular processes including cell signaling, immune response, and cancer progression.</p>

<p>Rabbit polyclonal TPRKB antibody</p>

<p>Rabbit polyclonal USF2 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth, preventing transcription and replication. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Its active form undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed by Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Rat monoclonal CD43 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATG10 antibody, catalog no. 70R-3584</p>

<p>Rabbit polyclonal RAB24 antibody</p>

<p>The Tropomyosin antibody is a highly reactive monoclonal antibody that specifically targets glial fibrillary acidic protein (GFAP). It is widely used in life sciences research to study the expression and localization of GFAP, which is an important marker for astrocytes. This antibody has been extensively validated and shown to have high affinity and specificity for GFAP. It can be used in various applications such as immunohistochemistry, western blotting, and ELISA. Additionally, the Tropomyosin antibody has potential diagnostic applications as it can be used to detect GFAP in human serum samples, making it a valuable tool for the development of diagnostic agents.</p>

<p>The LPL antibody is a growth factor that belongs to the class of antibodies. It is a monoclonal antibody that specifically targets androgen, collagen, low density lipoprotein (LDL), endothelial growth factors, nuclear proteins, fibronectin, and serum albumin binding. This antibody has been extensively studied in the field of life sciences and has shown promising results in various applications. It can be used in research studies to investigate the role of specific proteins or molecules in cellular processes. Additionally, the LPL antibody has potential therapeutic applications in the development of targeted treatments for diseases related to dysregulation of these proteins or molecules. With its high specificity and affinity, this antibody offers great potential for advancing scientific research and improving healthcare outcomes.</p>

<p>The ARNT antibody is a highly specific antibody that is used in various life sciences applications. It is commonly used in agglutination assays and antigen-antibody reactions to detect the presence of ARNT (Aryl hydrocarbon receptor nuclear translocator) protein. This antibody can be used with different sample types, including liver microsomes, to study the role of ARNT in protein kinase signaling pathways. Additionally, the ARNT antibody has been shown to interact with oncostatin and leukemia inhibitory factor, both of which are important factors in cell proliferation and differentiation. The use of this specific antibody allows for precise detection and analysis of ARNT protein levels, providing valuable insights into its functional role in various biological processes.</p>

<p>THRA antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Mouse monoclonal DLD antibody</p>

<p>FAM20C antibody was raised using the middle region of FAM20C corresponding to a region with amino acids CFYGECSYYCSTEHALCGKPDQIEGSLAAFLPDLSLAKRKTWRNPWRRSY</p>

<p>CCBP2 antibody was raised in rabbit using the N terminal of CCBP2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C13orf31 antibody, catalog no. 70R-4182</p>

<p>Rabbit polyclonal TFIP8 antibody</p>

<p>Purified Rabbit polyclonal PLEKHJ1 antibody</p>

<p>Rabbit polyclonal IFIT1 antibody</p>

<p>Purified recombinant phrB protein (His tag)</p>

<p>YHO-13351 is a potent and selective activator of the TRPA1 ion channel. It has been shown to inhibit the activity of protein kinase C (PKC) and PKC-dependent phospholipase A2, which are enzymes that regulate inflammatory responses. YHO-13351 has also been shown to be an antagonist for the β2 adrenergic receptor. The high purity of this compound enables its use as a research tool in cell biology and pharmacology.</p>

<p>ELISA kit for detection of CD27 (TNFRSF7) in the research laboratory</p>

<p>The MMP3 antibody is a monoclonal antibody that specifically targets and binds to matrix metalloproteinase 3 (MMP3). MMP3 is an enzyme involved in the breakdown of collagen, which plays a crucial role in various physiological processes. This antibody has antiviral properties and can be used in research and diagnostic applications in Life Sciences.</p>

<p>The Cyclin A1 antibody is a highly specialized monoclonal antibody that targets the protein Cyclin A1. This antibody has been extensively studied for its role in regulating cell growth and division. It has been shown to interact with various growth factors, including TGF-beta and androgen, forming a protein complex that influences cell cycle progression.</p>

<p>FKBPL antibody was raised using the N terminal of FKBPL corresponding to a region with amino acids METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELE</p>

<p>Beta-2 microglobulin antibody (HRP) was raised in rabbit using beta-2-microglobulin from human urine as the immunogen.</p>

<p>Influenza B antibody was raised in mouse using Influenza B as the immunogen.</p>

<p>The MASH1 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and inhibits the growth factor MASH1. This antibody has been extensively studied and proven to be highly effective in blocking the activity of MASH1, making it an invaluable tool for researchers studying the role of this growth factor in various biological processes.</p>

<p>Purified recombinant MRPL28 protein</p>

<p>SLC25A21 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYKGILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPALTFAIAGLGSGL</p>

<p>Purified Polyclonal Histamine H2 Receptor antibody</p>

<p>Purified native Bovine Troponin I protein (Cardiac)</p>

<p>PCGF4 antibody was raised in rabbit using the C terminal of PCGF4 as the immunogen</p>

<p>Rabbit polyclonal Keratin 18 antibody (Ser33)</p>

<p>MYL2 antibody was raised in mouse using recombinant human MYL2 (1-166aa) purified from E. coli as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively inhibiting bacterial growth and preventing transcription and replication. Extensive research has demonstrated its high efficacy, with studies conducted using a patch-clamp technique on human erythrocytes.</p>

<p>Mouse monoclonal Vibrio cholerae O139 antibody</p>

<p>Collagenase (bacterial) antibody</p>

<p>ATE1 antibody was raised using the N terminal of ATE1 corresponding to a region with amino acids CCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTM</p>

<p>FAM55D antibody was raised using the C terminal of FAM55D corresponding to a region with amino acids TYSVKEMEYLTRAIDRTGGEKNTVIVISLGQHFRPFPIDVFIRRALNVHK</p>

<p>TNFRSF21 antibody was raised using the N terminal of TNFRSF21 corresponding to a region with amino acids TTTAQPEQKASNLIGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRV</p>

<p>Mouse monoclonal GPHN antibody</p>

<p>The TPSAB1 antibody is a biomolecule that belongs to the class of polyclonal antibodies. It specifically targets and binds to the epidermal growth factor, which is a nuclear-activated protein involved in various biological processes. This antibody is widely used in the field of Life Sciences for research purposes, particularly in studies related to epidermal growth and its role in cell signaling pathways.</p>

<p>Sparfloxacin is a peptide that is used as a research tool in cell biology and pharmacology. It binds to the anti-sigma factor, which is involved in the regulation of ribosomal RNA (rRNA) synthesis. This binding prevents the formation of an rRNA transcription complex with the 50S ribosomal subunit, inhibiting protein synthesis and cell division. Sparfloxacin can also inhibit ion channels by binding to their ligand-binding sites, reducing the flow of ions through these channels.</p>

<p>Rat monoclonal CD9 antibody (PE)</p>

<p>CELSR3 antibody is a powerful antiviral agent that targets the lipoprotein lipase, a key enzyme involved in viral replication. This monoclonal antibody acts as a medicament by neutralizing the growth factor required for viral proliferation. The colloidal nature of this antibody allows for efficient targeting and binding to specific viral particles. Additionally, CELSR3 antibody exhibits high specificity towards the CD20 antigen, making it an effective therapeutic option for diseases characterized by abnormal CD20 expression. Its unique glycosylation pattern and fatty acid modifications enhance its stability and prolong its half-life in circulation. With its potent antiviral properties and precise targeting capabilities, CELSR3 antibody is a promising tool in the field of life sciences for combating viral infections.</p>

<p>GLPG 0974 is an experimental pharmaceutical compound, specifically an antagonist of the free fatty acid receptor 2 (FFA2), also known as GPR43. This compound is synthesized through a process of chemical engineering aimed at selectively inhibiting GPR43's activity. The mode of action involves blocking the interaction of short-chain fatty acids with GPR43, a receptor implicated in inflammatory pathways.</p>

<p>Rabbit polyclonal SLC1A4 antibody</p>

<p>HDLBP antibody was raised using a synthetic peptide corresponding to a region with amino acids RLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILRIVGELEQMV</p>

<p>RABL4 antibody was raised using the C terminal of RABL4 corresponding to a region with amino acids RAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA</p>

<p>KIR2DS4 antibody was raised in Rabbit using Human KIR2DS4 as the immunogen</p>

<p>Rabbit polyclonal RPL40 antibody</p>

<p>TRIM72 antibody was raised using the middle region of TRIM72 corresponding to a region with amino acids LEELTFDPSSAHPSLVVSSSGRRVECSEQKAPPAGEDPRQFDKAVAVVAH</p>

<p>Rabbit polyclonal OR2H2 antibody</p>

<p>MAGOH antibody was raised in Rabbit using Human MAGOH as the immunogen</p>

<p>Mouse lymphocyte antibody was raised in rabbit using RBC-free rannit thymus and spleen cells as the immunogen.</p>

<p>Rabbit polyclonal SRF antibody (Ser77)</p>

<p>The Glycogen Synthase antibody is a growth factor that plays a crucial role in various biological processes. It belongs to the class of antibodies and binding proteins that are involved in immunomodulation. This antibody has been shown to have cytotoxic and antiviral properties, making it a potential candidate for the development of anticancer agents and antiviral therapies. The Glycogen Synthase antibody can neutralize specific targets by binding to specific epitopes on their surface, thereby inhibiting their activity. With its polyclonal and monoclonal variants, this antibody offers a wide range of applications in Life Sciences research and clinical settings.</p>

<p>The KLF4 antibody is a powerful tool used in Life Sciences for ultrasensitive detection and analysis. It is designed to specifically target and bind to the KLF4 protein, which plays a crucial role in cell growth and development. This monoclonal antibody can be used in various applications such as immunoassays, Western blotting, and immunohistochemistry.</p>

<p>KIFAP3 antibody was raised using the middle region of KIFAP3 corresponding to a region with amino acids WLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEG</p>

<p>Armenian Hamster monoclonal CD95 Ligand antibody (PE)</p>

<p>Mouse monoclonal KATNB1 antibody</p>

<p>INPP5J antibody was raised in Rabbit using Human INPP5J as the immunogen</p>

<p>Rabbit polyclonal ARHGAP15 antibody</p>

<p>Mouse monoclonal HAV2C antibody</p>

<p>ARR3 antibody was raised in rabbit using the middle region of ARR3 as the immunogen</p>

<p>KLHL13 antibody was raised in Mouse using a purified recombinant fragment of human KLHL13 expressed in E. coli as the immunogen.</p>

<p>Purified Polyclonal CD295 antibody</p>

<p>Rabbit polyclonal CHST9 antibody</p>

<p>The CD89 antibody is a highly specialized polyclonal antibody that is used in the field of life sciences. It is specifically designed to target and bind to the glial fibrillary acidic protein kinase, which plays a crucial role in various cellular processes. This antibody has been extensively tested and proven to be effective in detecting and quantifying the levels of glial fibrillary acidic protein kinase in various biological samples.</p>

<p>Purified recombinant GLUD1 protein (His tag)</p>

<p>PDGFD antibody was raised using the N terminal of PDGFD corresponding to a region with amino acids NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH</p>

<p>Rat monoclonal CD117 antibody (biotin)</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>Mouse monoclonal LENG1 antibody</p>

<p>The RAB22A antibody is a highly specialized monoclonal antibody that targets the glycan structures found in human serum. This antibody has been extensively studied and has shown promising results in various areas of research, including cancer biology and immunology.</p>

<p>SLC5A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDNGIYNQKFPFKTLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAV</p>

<p>C16ORF48 antibody was raised using the C terminal Of C16Orf48 corresponding to a region with amino acids DLWRREAEARKQSQPDPAMPPGHTRMPENQRLETLTKLLQSQSQLLRELV</p>

<p>MIF protein is a monoclonal antibody that specifically targets and neutralizes the activity of tumor necrosis factor-alpha (TNF-α). This protein has been extensively studied in the field of life sciences and is widely used in research applications. MIF protein is capable of binding to antigenic peptides and can be conjugated with other proteins for various experimental purposes. It has been shown to activate growth factors and inhibit the production of inflammatory cytokines. Additionally, MIF protein can be used in cytotoxic assays or as an electrode for polymerase chain reactions. Its inhibitory factor properties make it a valuable tool in studying angiopoietin-like 3 (ANGPTL3) and other related molecules.</p>

<p>Alkaline phosphatase antibody was raised in mouse using purified human placenta ALP as the immunogen.</p>

<p>Rabbit polyclonal WRKY62 antibody</p>

<p>Rabbit polyclonal VASH1 antibody</p>

<p>Mouse monoclonal RAD51B antibody</p>

<p>The S100P antibody is a monoclonal antibody that targets the protein S100P. S100P is a chemokine-like protein that has been implicated in various biological processes, including cell growth, differentiation, and inflammation. It is also associated with certain diseases, such as circovirus infection and cancer.</p>

<p>Mouse monoclonal C9orf41 antibody</p>

<p>Rabbit polyclonal Retinoblastoma antibody (Ser608)</p>

<p>The ALDOC antibody is a polyclonal antibody that is used in the field of Life Sciences. It specifically targets the ALDOC protein, which is involved in various cellular processes such as chemokine production, acetylation, and natriuretic regulation. This antibody can be used to study the expression and localization of ALDOC in different tissues and cell types.</p>

<p>Chondroadherin antibody was raised using the middle region of CHAD corresponding to a region with amino acids VDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWL</p>

<p>ZNF415 antibody was raised in rabbit using the C terminal of ZNF415 as the immunogen</p>

<p>SLC39A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIESQIQKFMVQNRSASERNSSGDADSAHMEYPYGELIISLGFFFVFFLE</p>