Bioquímicos e reagentes

<p>The MDM2 antibody is a powerful tool used in life sciences research. It is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific needs. This antibody targets MDM2, a protein that plays a crucial role in regulating cell growth and division.</p>

<p>Chodl antibody was raised in rabbit using the C terminal of Chodl as the immunogen</p>

<p>EPHA7 antibody was raised in Mouse using a purified recombinant fragment of EPHA7(aa27-210) expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal BCL-XL antibody</p>

<p>Rabbit polyclonal DBF4 antibody</p>

<p>Rabbit polyclonal p53 antibody (Ser376)</p>

<p>Rabbit polyclonal PSPN antibody</p>

<p>Keratin K18 antibody was raised in mouse using human keratin K18 from HeLa cytoskeletal preparation as the immunogen.</p>

<p>The HSL antibody is a monoclonal antibody that specifically targets and inhibits the activity of phosphatase enzymes. This antibody is widely used in Life Sciences research to study the role of phosphatases in various cellular processes. It has been shown to effectively block the activity of phosphatases involved in signal transduction pathways, such as those activated by growth factors and cytokines like TNF-α and chemokines.</p>

<p>Rabbit polyclonal PCK2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Sgk3 antibody, catalog no. 70R-9338</p>

<p>Mouse monoclonal EPSP synthase antibody</p>

<p>The VASP antibody is a hormone peptide that plays a crucial role in various biological processes. It is commonly used in Life Sciences research and has proven to be an invaluable tool for scientists studying cellular signaling pathways. The VASP antibody has been extensively studied and characterized, with its binding specificity confirmed through molecular docking experiments.</p>

<p>Purified recombinant CCL3 protein (Mouse) (His tag)</p>

<p>CXCL3 antibody was raised in Rabbit using Human CXCL3 as the immunogen</p>

<p>YES1 antibody was raised in Mouse using a purified recombinant fragment of YES(aa10-193) expressed in E. coli as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is known for its bactericidal activity against tuberculosis infection. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth, preventing transcription and replication. This drug has been extensively studied and shown to be highly effective using advanced techniques such as the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Chondroitin-6 sulfate antibody was raised in mouse using chondroitinase ABC-digested adult human aggrecan as the immunogen.</p>

<p>HSPB7 antibody was raised in Rabbit using Human HSPB7 as the immunogen</p>

<p>GARS antibody was raised using the middle region of GARS corresponding to a region with amino acids IEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQN</p>

<p>Rabbit polyclonal AIRE antibody</p>

<p>Purified recombinant Cathepsin F protein (His tag)</p>

<p>205-324 amino acids: MGSSHHHHHH SSGLVPRGSH MAPTTEGEQK SHEVIKFMDV YQRSYCRPIE TLVDIFQEYP DEIEYIFKPS CVPLMRCAGC CNDEALECVP TSESNITMQI MRIKPHQSQH IGEMSFLQHS RCECRPKKDR TKPEKCDKPR R</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RBM35B antibody, catalog no. 70R-4967</p>

<p>The PDGFR beta antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to the platelet-derived growth factor receptor beta (PDGFRβ) protein. This antibody is commonly used in various laboratory techniques such as Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SSR1 antibody, catalog no. 70R-6619</p>

<p>Goat anti Rat IgG (H + L) secondary antibody (FITC)</p>

<p>18:0-Phodag is a synthetic ligand that binds to the extracellular domain of the human β2-adrenergic receptor. It is a potent full agonist at this receptor. 18:0-Phodag has been shown to be an antagonist at other G protein-coupled receptors, including the α1A and α1B subtypes of the adrenergic receptor and the δ1, δ2, and δ3 subtypes of dopamine receptors. The binding of 18:0-phodag to these receptors leads to inhibition of adenylyl cyclase and reduces intracellular cAMP levels. 18:0-Phodag has also been shown to inhibit phospholipase C (PLC) activity by blocking activation of PLCβ2 with phosphatidylinositol 4,5-bisphosphate (PIP2).</p>

<p>ORC6L antibody was raised in mouse using recombinant Human Origin Recognition Complex, Subunit 6 Like (Yeast) (Orc6L)</p>

<p>TRIML2 antibody was raised using the middle region of TRIML2 corresponding to a region with amino acids SEDLRTMRLRHGQQDGAGNPERLDFSAMVLAAESFTSGRHYWEVDVEKAT</p>

<p>Goat anti-rabbit IgG (biotin) was raised in goat using rabbit IgG F(ab')2 fragment as the immunogen.</p>

<p>MBP antibody was raised in Mouse using recombinant fusion protein with Maltose binding protein tag as the immunogen.</p>

<p>CCR8 antibody was raised in goat using a synthetic peptide PNVTMTDYYPDFFTAPCDAEFLLRGSM corresponding to amino acid residues 7-33 of mouse CCR8.   as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NDST3 antibody, catalog no. 70R-7320</p>

<p>BATF2 antibody was raised in rabbit using the N terminal of BATF2 as the immunogen</p>

<p>Mouse monoclonal RNF144B antibody</p>

<p>Pneumocystis carinii antibody was raised in mouse using Pneumocystis carinii isolates as the immunogen.</p>

<p>MGC33407 antibody was raised using the middle region of MGC33407 corresponding to a region with amino acids DHPLLFSDPPFSPATNREKLVEVAFESLRSPAMYVASQSVLSVYAHGRVS</p>

<p>Rabbit polyclonal NRTN antibody</p>

<p>The RASGRP4 antibody is a highly effective medicament that targets the circumsporozoite protein. This antibody specifically binds to the activated form of the protein, which is located in the nucleus. It has been shown to inhibit the activity of VEGF-C, human chorionic gonadotropin, and other antigens involved in angiogenesis. The RASGRP4 antibody can be used in immunohistochemistry studies to detect and visualize these proteins in various tissues. This product is a polyclonal antibody, meaning it is derived from multiple sources and provides a broad range of specificity. It is widely used in life sciences research to study endothelial growth factors and their role in various biological processes. With its high-quality performance and reliable results, this antibody is an essential tool for scientists and researchers working in the field of molecular biology.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM56 antibody, catalog no. 70R-8383</p>

<p>Affinity purified Rabbit polyclonal NDUFAB1 antibody</p>

<p>Rabbit polyclonal PSME1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Ankrd13d antibody, catalog no. 70R-9367</p>

<p>DDX28 antibody was raised in Rabbit using Human DDX28 as the immunogen</p>

<p>ARL5A antibody was raised using the middle region of ARL5A corresponding to a region with amino acids YKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQA</p>

<p>The ERK1/2 antibody is a monoclonal antibody that specifically targets the ERK1 and ERK2 proteins. These proteins are part of the mitogen-activated protein kinase (MAPK) signaling pathway, which plays a crucial role in cell proliferation, differentiation, and survival. The ERK1/2 antibody can be used for various applications in life sciences research, including western blotting, immunohistochemistry, and flow cytometry.</p>

<p>GRK5 antibody was raised using the middle region of GRK5 corresponding to a region with amino acids FYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEG</p>

<p>Mouse monoclonal PKLR antibody</p>

<p>The SOCS3 antibody is a monoclonal antibody that plays a crucial role in regulating plasma levels of various growth factors. This antibody specifically targets the SOCS3 protein, which is involved in the negative regulation of cytokine signaling pathways. By binding to the SOCS3 protein, this antibody prevents its interaction with other proteins, thereby enhancing the activity of growth factors.</p>

<p>The c-kit antibody is a highly effective monoclonal antibody that specifically targets the c-kit receptor protein. This receptor is involved in various cellular processes, including cell growth and differentiation. The c-kit antibody works by binding to the c-kit receptor and blocking its activity, thereby inhibiting the growth of cancer cells.</p>

<p>The Synapsin antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets synapsin, a protein involved in the regulation of neurotransmitter release and synaptic function. This antibody can be used to study the role of synapsin in various cellular processes, including neuronal development, synaptic plasticity, and neurotransmission.</p>

<p>ML132 is a dichroic compound that has been shown to have inhibitory effects on the acid complex in cardiac cells. It also has biochemical properties that are similar to those of a known inhibitor of the mitochondrial enzyme, aconitase. ML132 has been shown to be effective in reducing blood pressure and increasing the autophagy rate in animals. This drug may also have an effect on retinal tissue because it is highly soluble in organic solvents. The optical system used for this research was a sectioning system with microlenses and was used to study the effects of ML132 on neurons from rats.</p>

<p>The CBR1 antibody is a highly specific and potent antibody that targets CBR1, an enzyme involved in various cellular processes. This antibody is widely used in life sciences research and has applications in fields such as epidermal growth factor signaling, adipose tissue biology, and serotonin metabolism. It can be used to study the role of CBR1 in different cellular pathways and to investigate its potential as a therapeutic target. The CBR1 antibody is available as a polyclonal antibody and has been validated for use in various experimental techniques, including immunohistochemistry, Western blotting, and ELISA. With its high specificity and sensitivity, this antibody is a valuable tool for researchers looking to explore the functions of CBR1 in different biological systems.</p>

<p>BSA conjugated Streptomycin Hapten</p>

<p>Sheep polyclonal Virginiamycin antibody</p>

<p>FGFR2 antibody was raised in Rabbit using Human FGFR2 as the immunogen</p>

<p>Armenian Hamster monoclonal CD48 antibody (allophycocyanin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MARVELD2 antibody, catalog no. 70R-6334</p>

<p>Purified recombinant PTMS protein (His tag)</p>

<p>The PSAP antibody is a growth factor antigen that plays a crucial role in various biological processes. It is an essential tool in the field of Life Sciences, particularly in antibody research. The PSAP antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs.</p>

<p>CAPZA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGEC</p>

<p>NAT13 antibody was raised using the C terminal of NAT13 corresponding to a region with amino acids AIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN</p>

<p>Rabbit polyclonal COX5B antibody (FITC)</p>

<p>Recombinant human SRGN protein (His tag)</p>

<p>1-321 amino acids: MGTTKHSKLL ILGSGPAGYT AAVYAARANL QPVLITGMEK GGQLTTTTEV ENWPGDPNDL TGPLLMERMH EHATKFETEI IFDHINKVDL QNRPFRLNGD NGEYTCDALI IATGASARYL GLPSEEAFKG RGVSACATCD GFFYRNQKVA VIGGGNTAVE EALYLSNIAS EVHLIHRRDG FRAEKILIKR LMDKVENGNI ILHTNRTLEE VTGDQMGVTG VRLRDTQNSD NIESLDVAGL FVAIGHSPNT AIFEGQLELE NGYIKVQSGI HGNATQTSIP GVFAAGDVMD HIYRQAITSA GTGCMAALDA ERYLDGLADA K</p>

<p>LIX1L antibody was raised using a synthetic peptide corresponding to a region with amino acids AGSPAVLREAVEAVVRSFAKHTQGYGRVNVVEALQEFWQMKQSRGADLKN</p>

<p>The GPR101 antibody is a high-quality antibody that is designed to neutralize the activity of GPR101, a protein complex involved in various biological processes. This antibody is produced using advanced techniques and has been extensively tested for its specificity and effectiveness. It has been shown to effectively bind to GPR101 in human serum, making it an ideal tool for research in the field of Life Sciences. The GPR101 antibody can be used in a variety of applications, including Western blotting, immunohistochemistry, and ELISA assays. With its exceptional performance and reliability, this antibody is a valuable asset for scientists studying GPR101 and related proteins such as c-myc, fibronectin, collagen, globulin, telomerase, alpha-fetoprotein, and more. Choose the GPR101 antibody for accurate and reliable results in your experiments.</p>

<p>Purified Polyclonal ADPGK antibody</p>

<p>Horse IgG (H + L) purified protein</p>

<p>Rabbit polyclonal RAD51L1 antibody</p>

<p>HSD17B14 antibody was raised using a synthetic peptide corresponding to a region with amino acids QPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIP</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TLK2 antibody, catalog no. 70R-2288</p>

<p>ZFYVE20 antibody was raised in rabbit using the N terminal of ZFYVE20 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EIF3EIP antibody, catalog no. 70R-4419</p>

<p>Rabbit polyclonal T3JAM antibody</p>

<p>Purified recombinant Human S100A15 Protein (His tag)</p>

<p>Mouse monoclonal FAM40A antibody</p>

<p>Rabbit polyclonal UFD1L antibody</p>

<p>WFDC5 antibody was raised using the N terminal of WFDC5 corresponding to a region with amino acids MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGPCLLSVPDQCV</p>

<p>Mouse monoclonal Cytokeratin 8+18 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LYPD5 antibody, catalog no. 70R-4270</p>

<p>Purified Rabbit polyclonal OR6K2 antibody</p>

<p>Recombinant human RGN protein</p>

<p>Recombinant Rabies virus Glycoprotein(G), partial</p>

<p>LY2606368 is a monoclonal antibody that binds to the death protein and prevents it from activating other proteins that promote cell growth. It has been shown to be effective in treating pediatric patients with metastatic pancreatic cancer. LY2606368 is a potent inhibitor of the epidermal growth factor receptor (EGFR) tyrosine kinase, which is associated with tumorigenesis. Prexasertib has been shown to induce cell lysis and apoptosis by inhibiting the Bcl-2 family of proteins, which regulate mitochondrial membrane permeability. This drug also inhibits phosphatidylinositol 3-kinases (PI3Ks) and cyclooxygenases, which are involved in tumorigenesis.</p>

<p>MALT1 antibody was raised in Rabbit using Human MALT1 as the immunogen</p>

<p>Rabbit polyclonal LPAR3 antibody</p>

<p>Rabbit polyclonal EGFR antibody (Ser1026)</p>

<p>GFAP antibody was raised in Mouse using a purified recombinant fragment of human GFAP expressed in E. coli as the immunogen.</p>

<p>The Influenza A antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to the influenza A virus, preventing its replication and spread. It has been shown to inhibit the production of tumor necrosis factor-alpha (TNF-α), a cytokine involved in inflammation and immune response. Additionally, this antibody has been found to inhibit hemolysis, a process where red blood cells are destroyed. It also exhibits anti-vascular endothelial growth factor (anti-VEGF) activity, blocking the growth of new blood vessels that can contribute to tumor development. Furthermore, it has been shown to neutralize chemokines, which are signaling proteins involved in immune cell recruitment. The Influenza A antibody is an essential tool for researchers studying viral infections and autoimmune diseases. Its versatility and effectiveness make it a valuable asset in various scientific disciplines.</p>

<p>α-Mycolic acid (c80) is a complex lipid product, which is derived from the cell wall of mycobacteria, particularly species like Mycobacterium tuberculosis. This lipid is characterized by its unique long-chain hydrocarbon structure, typically containing 80 carbon atoms. It plays a critical role in the integrity and pathogenicity of the mycobacterial cell wall by forming a protective barrier that contributes to the organism’s resistance to environmental stress and antibiotics.</p>

<p>OR2C1 antibody was raised in rabbit using the C terminal of OR2C1 as the immunogen</p>

<p>Rabbit polyclonal CNTF antibody (FITC)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DAPP1 antibody, catalog no. 70R-3878</p>

<p>QTRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FMPVGTQATMKGITTEQLDALGCRICLGNTYHLGLRPGPELIQKANGLHG</p>

<p>Recombinant human PHOSPHO2 protein (His tag)</p>

<p>CES3 antibody was raised in rabbit using the C terminal of CES3 as the immunogen</p>

<p>CHCHD1 antibody was raised using the N terminal of CHCHD1 corresponding to a region with amino acids MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMS</p>

<p>MAGEA1 antibody was raised in Rabbit using Human MAGEA1 as the immunogen</p>