Bioquímicos e reagentes

<p>Rabbit polyclonal RBMS2 antibody</p>

<p>Mouse monoclonal hCG antibody (Prediluted for IHC)</p>

<p>RAD18 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEI</p>

<p>Guinea pig polyclonal Hemoglobin antibody (biotin)</p>

<p>Purified Polyclonal Annexin A6 antibody</p>

<p>Rabbit polyclonal SLC27A3 antibody</p>

<p>EWSR1 antibody was raised using the middle region of EWSR1 corresponding to a region with amino acids QPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQS</p>

<p>MINA antibody was raised in Rabbit using Human MINA as the immunogen</p>

<p>GRM5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal VTI1A antibody</p>

<p>C19ORF46 antibody was raised using the N terminal Of C19Orf46 corresponding to a region with amino acids GEESTSPEQAQTLGQDSLGPPEHFQGGPRGNEPAAHPPRWSTPSSYEDPA</p>

<p>Recombinant Human IP6K2 protein (His tag)</p>

<p>Tcf7l2 antibody was raised in rabbit using the N terminal of Tcf7l2 as the immunogen</p>

<p>Rabbit polyclonal CLCN6 antibody</p>

<p>The ROBO4 antibody is a monoclonal antibody that has been developed for various assays and treatments in the field of Life Sciences. It specifically targets and binds to ROBO4, a protein involved in angiogenesis. This antibody can be used in solid phase assays to detect and quantify the levels of ROBO4 in biological samples. Additionally, it can be used as an inhibitor to block the interaction between ROBO4 and its ligands, thereby preventing angiogenesis. The ROBO4 antibody has shown promising results in preclinical studies as a potential therapeutic option for diseases characterized by abnormal blood vessel formation. Its high specificity and affinity make it a valuable tool for researchers studying angiogenesis and developing new treatments and/or prophylaxis strategies.</p>

<p>CHEK2 antibody was raised in rabbit using the N terminal of CHEK2 as the immunogen</p>

<p>ZNF364 antibody was raised using the C terminal Of Znf364 corresponding to a region with amino acids PWLELHDTCPVCRKSLNGEDSTRQSQSTEASASNRFSNDSQLHDRWTF</p>

<p>TG Antibody is a highly effective polyclonal antibody used in the field of Life Sciences. It has neutralizing properties and is specifically designed to target and bind to EGF-like (epidermal growth factor-like) molecules. This antibody can be used for various applications, including the detection and quantification of EGF-like proteins, as well as in research studies involving cell signaling pathways and growth factor interactions.</p>

<p>Mouse monoclonal DSTN antibody</p>

<p>Mouse monoclonal RNF144B antibody</p>

<p>MOGS antibody was raised in Rabbit using Human MOGS as the immunogen</p>

<p>Rabbit polyclonal MAZ antibody</p>

<p>Dienestrol p-OH Conjugate for use in immunoassays</p>

<p>Rabbit polyclonal SSR2 antibody</p>

<p>CCDC63 antibody was raised using the middle region of CCDC63 corresponding to a region with amino acids IEDFLAKEEKNFARFTYVTELNNDMEMMHKRTQRIQDEIILLRSQQKLSH</p>

<p>Rabbit polyclonal SDPR antibody</p>

<p>The CLPP antibody is a monoclonal antibody that targets the CLPP protein, which plays a crucial role in cellular processes. It has been shown to activate AMPK (5'-monophosphate-activated protein kinase), a key regulator of energy metabolism. This antibody specifically binds to CLPP and forms complexes with it, leading to the activation of various signaling pathways. In addition, the CLPP antibody has been found to interact with other synaptic proteins and promote their function in primary neuron cultures. It also enhances the production of colony-stimulating factors and chemokines, which are important for immune response and cell growth. Furthermore, this antibody has been shown to have autoantibody properties, indicating its potential role in autoimmune diseases. Overall, the CLPP antibody is a versatile tool for studying cellular processes and can be used in various research applications such as protein analysis, immunoprecipitation, and Western blotting.</p>

<p>Rabbit polyclonal RAD9A antibody</p>

<p>Rat thymocyte antibody was raised in rabbit using RBC-free rat thymus and spleen cells as the immunogen.</p>

<p>Olaquindox antibody is a polyclonal antibody that specifically targets the surface glycoprotein of Cryptosporidium parvum. This antibody forms an antigen-antibody complex, which can be detected using various immunoassays such as electrochemical impedance spectroscopy (EIS) or viability assays. Olaquindox antibody is widely used in the field of life sciences for research purposes and diagnostic applications related to Cryptosporidium infections. It is available both as a polyclonal and monoclonal antibody, providing researchers with options for their specific experimental needs. With its high specificity and sensitivity, Olaquindox antibody plays a crucial role in advancing our understanding of Cryptosporidium biology and developing effective strategies for disease control.</p>

<p>The CP23 antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets tumor necrosis factor-alpha (TNF-α), which is a cytokine involved in inflammation and immune responses. CP23 antibody has been extensively studied for its potential therapeutic applications, particularly in diseases where TNF-α plays a significant role.</p>

<p>ADRA1B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Purified recombinant ACAD8 protein (His tag)</p>

<p>SGCB protein is an important component of the cell membrane and plays a crucial role in muscle function. It is an antigen that can be targeted by antibodies, making it a valuable tool for research and diagnostic purposes. The SGCB protein has been shown to have anti-glial fibrillary acidic properties, which may be relevant in the treatment of certain neurological disorders. Additionally, conjugated proteins containing SGCB can be used as inhibitors or therapeutic agents. Monoclonal antibodies targeting SGCB protein have been developed and are widely used in various applications, including immunoassays and immunohistochemistry. The detection of SGCB protein in human serum samples has proven to be a useful biomarker for certain diseases. Overall, the SGCB protein is a significant molecule in life sciences research with diverse applications and potential therapeutic implications.</p>

<p>Purified recombinant CALR3 protein</p>

<p>RPS6KA2 antibody was raised using the middle region of RPS6KA2 corresponding to a region with amino acids LSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTR</p>

<p>The RAB27B antibody is a polyclonal antibody that specifically targets the RAB27B protein. This protein plays a crucial role in various cellular processes, including acrosome reactions and calcium binding. By binding to RAB27B, this antibody can modulate its function and exert immunomodulatory effects.</p>

<p>Rabbit polyclonal Chk1 antibody (Ser345)</p>

<p>Rabbit polyclonal TPST1 antibody</p>

<p>Purified recombinant ANKRA2 protein (His tag)</p>

<p>OAS1 antibody was raised using the N terminal of OAS1 corresponding to a region with amino acids MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSS</p>

<p>LPCAT4 antibody was raised in Rabbit using Human LPCAT4 as the immunogen</p>

<p>Mouse monoclonal C2orf40 antibody</p>

<p>This antibody reacts with heavy chains on chicken IgG (IgY) and light chains on all chicken immunoglobulins.</p>

<p>Goat anti-rabbit IgG (H+L) (Poly-HRP40) was raised in goat using rabbit IgG as the immunogen.</p>

<p>Portion of EBV EBNA 4NP</p>

<p>Rabbit Polyclonal PLEKHG3 antibody</p>

<p>Rat monoclonal CIRE antibody (PE)</p>

<p>Rabbit polyclonal bZIP23 antibody</p>

<p>Rabbit polyclonal IL6 antibody (FITC)</p>

<p>Rabbit polyclonal GS15 antibody</p>

<p>SPAG8 antibody was raised using the N terminal of SPAG8 corresponding to a region with amino acids SGPVLGSSSGAGHGSGSGSGPGCGSVPGSGSGPGPGSGPGSGPGHGSGSH</p>

<p>KIF1B antibody was raised in Rabbit using Human KIF1B as the immunogen</p>

<p>Pancreastatin antibody was raised in rabbit using synthetic pancreastatin as the immunogen.</p>

<p>Mouse Lymphocyte antibody was raised in rabbit using RBC-free murine thymus and spleen cells as the immunogen.</p>

<p>Melinamide is a fatty acid analog that is used for the treatment of inflammatory bowel disease. It has been shown to regulate the production of pro-inflammatory cytokines, such as tumor necrosis factor-α (TNF-α) and interleukin-1β (IL-1β), in rat liver microsomes. Melinamide has also been shown to decrease oxidative stress on heart tissue and reduce metabolic disorders, such as type 2 diabetes, in rats. In addition, melinamide inhibits the production of TNF-α by human macrophages and reduces inflammation caused by bowel disease in rats. Melinamide is not active against bacterial infections and does not have any significant effects on skin cells or x-ray crystal structures.</p>

<p>Hps3 antibody was raised in rabbit using the N terminal of Hps3 as the immunogen</p>

<p>The CD43 antibody is a monoclonal antibody used in Life Sciences research. It targets the CD43 protein, which is involved in various cellular processes including mitogen-activated protein and growth factor signaling. The antibody has been shown to inhibit the polymerase activity of activated cells and has cytotoxic effects on certain cell types. Additionally, it has antiviral properties and can target Mycoplasma genitalium, an acidic bacterium that causes infections in humans. The CD43 antibody also interacts with nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB), endonuclease caspase-9, and β-catenin, further highlighting its potential applications in molecular biology research.</p>

<p>Rabbit Polyclonal EIF2S2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRIML2 antibody, catalog no. 70R-4258</p>

<p>NLGN4X antibody was raised using the N terminal of NLGN4X corresponding to a region with amino acids SILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEEN</p>

<p>The RGS4 antibody is a highly specialized antibody that has been developed for use in the field of Life Sciences. It is designed to target and bind to the RGS4 protein, which plays a crucial role in various cellular processes. This antibody is monoclonal, meaning it is derived from a single clone of cells and therefore offers high specificity and consistency in its performance.</p>

<p>C1ORF110 antibody was raised using the N terminal Of C1Orf110 corresponding to a region with amino acids LKVICLYHVKLLTWEQRQLQKELQRLQQAETMKKKFSSYLGNGFQKRPED</p>

<p>GUCY1B3 antibody was raised using the N terminal of GUCY1B3 corresponding to a region with amino acids LIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVV</p>

<p>Purified recombinant Human HBXIP protein (His tag)</p>

<p>Mouse monoclonal OTUB2 antibody</p>

<p>The GLO1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to the glyoxalase 1 enzyme, which plays a crucial role in detoxifying harmful reactive carbonyl compounds. This antibody has been extensively studied for its potential antiviral properties and has shown promising results in inhibiting viral replication.</p>

<p>Mouse monoclonal PIK3AP1 antibody</p>

<p>LSS antibody was raised in Rabbit using Human LSS as the immunogen</p>

<p>VPS37C antibody was raised using a synthetic peptide corresponding to a region with amino acids LQLEREMALATNRSLAERNLEFQGPLEISRSNLSDRYQELRKLVERCQEQ</p>

<p>The RCC1 antibody is a serum marker that is used in various assays and research in the field of Life Sciences. It is a monoclonal antibody that specifically targets RCC1, an important protein involved in cell cycle regulation. This antibody can be used to detect the presence of RCC1 in biological samples, making it a valuable tool for studying its expression and function. Additionally, the RCC1 antibody has been shown to have potential therapeutic applications, as it can be used to develop targeted medicines against diseases associated with abnormal RCC1 levels. With its high specificity and sensitivity, this antibody is widely used by researchers and scientists in their studies on sirtuins, interleukins, carnitine metabolism, and antiviral mechanisms.</p>

<p>The NEU2 antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody has been specifically designed to neutralize the toxic effects of alpha-fetoprotein (AFP) in human serum. By binding to AFP, the NEU2 antibody prevents its interaction with cell surface receptors and inhibits its downstream signaling pathways. This inhibition leads to a decrease in the production of colony-stimulating factors and other growth factors that are essential for tumor growth and metastasis.</p>

<p>Purified recombinant WBP2 protein (His tag)</p>

<p>Norfloxacin N Conjugate for use in immunoassays</p>

<p>Mouse monoclonal PTPN11 antibody</p>

<p>TUBB2b antibody was raised in mouse using recombinant human TUBB2b (1-445aa) purified from E. coli as the immunogen.</p>

<p>The HPV 18 protein is a recombinant protein that belongs to the category of Recombinant Proteins &amp; Antigens. It is commonly used in life sciences research and various applications related to proteins and antigens. This protein can be used in studies involving monoclonal antibodies, interferon, and antigen-antibody reactions. It has been shown to be activated when exposed to histidine and can generate autoantibodies and cytotoxic effects. Additionally, the HPV 18 protein has neutralizing properties and can be used for anticoagulation purposes. Researchers often utilize this protein in conjunction with electrodes for various experiments and analyses.</p>

<p>ACTH (1-24) antibody was raised in sheep using ACTH 1-24 conjugated to thyroglobulin as the immunogen.</p>

<p>Mouse lymphocyte antibody (FITC) was raised in rabbit using RBC-free mouse thymus and spleen cells as the immunogen.</p>

<p>Purified recombinant DHH protein (His tag)</p>

<p>OSBPL8 antibody was raised using the N terminal of OSBPL8 corresponding to a region with amino acids SQRQGKEAYPTPTKDLHQPSLSPASPHSQGFERGKEDISQNKDESSLSMS</p>

<p>The ZNF146 antibody is a highly specialized protein that belongs to the family of kinase inhibitors. It plays a crucial role in regulating various cellular processes, including natriuretic signaling and oncostatin activity. This human protein acts as a potent inhibitor of annexin-mediated cytotoxicity and fibrinogen immobilization. The ZNF146 antibody has shown significant potential in targeting caspase-9, an enzyme involved in programmed cell death, making it an essential tool for researchers studying apoptosis pathways. Additionally, this monoclonal antibody exhibits selective binding to acidic markers expressed by mesenchymal stem cells, making it an invaluable tool for stem cell research and therapeutic applications. With its high specificity and versatility, the ZNF146 antibody is a valuable asset for scientists seeking to unravel the intricacies of cellular mechanisms and develop innovative treatments.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MPEG1 antibody, catalog no. 70R-3787</p>

<p>Rabbit polyclonal TM7SF2 antibody</p>

<p>Mouse monoclonal CPO antibody</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.</p>

<p>Marcksl1 antibody was raised in Rabbit using Human Marcksl1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Zdhhc11 antibody, catalog no. 70R-8835</p>

<p>The ANXA10 antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets and detects progesterone, a steroid hormone involved in various physiological processes. This antibody can be used in immunoassays to measure progesterone levels in biological samples such as human serum or tissue extracts.</p>

<p>Rabbit polyclonal BAD antibody (Ser134)</p>

<p>Armenian Hamster monoclonal CD11c antibody (allophycocyanin)</p>

<p>HECA antibody was raised using a synthetic peptide corresponding to a region with amino acids HKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVF</p>

<p>Insulin antibody is a specialized protein that specifically binds to insulin molecules. It can be used in various research applications, such as studying the role of insulin in glucose metabolism or investigating insulin signaling pathways. The antibody is typically produced using monoclonal antibody technology, ensuring high specificity and sensitivity.</p>

<p>Mouse monoclonal TRAP1 antibody</p>

<p>SLC6A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFSILGFMAAEQGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFF</p>

<p>gp210 Antibody (C-terminal)</p>

<p>The Tryptophan Hydroxylase antibody is a crucial tool in Life Sciences research. This pluripotent stem cell-derived antibody is specifically designed for the detection and analysis of Tryptophan Hydroxylase, an enzyme involved in serotonin synthesis. With its high specificity and sensitivity, this antibody enables researchers to study the role of Tryptophan Hydroxylase in various biological processes.</p>

<p>IFN lambda 2 antibody was raised in rabbit using highly pure recombinant human IFN-lambda2 as the immunogen.</p>

<p>PWWP2B antibody was raised using the N terminal of PWWP2B corresponding to a region with amino acids ILLDCTKKSGLFGLPPLAPLPQVDESPVNDSHGRAPEEGDAEVMQLGSSS</p>

<p>The MIP antibody is a monoclonal antibody used in Life Sciences research. It specifically targets annexin, a protein involved in various cellular processes. This antibody can be used for the detection and quantification of annexin in biological samples. Additionally, it has been shown to have inhibitory effects on pancreatic glucagon and insulin, making it a valuable tool for studying the regulation of glucose metabolism. The MIP antibody is also used in the development of diagnostic tests for conditions such as diabetes, where aberrant levels of glucagon and insulin are observed. In addition to its applications in research, this antibody has potential therapeutic uses, particularly in the treatment of autoimmune disorders characterized by the production of autoantibodies against insulin or other target proteins.</p>