Bioquímicos e reagentes

<p>Rabbit polyclonal ARHGAP15 antibody</p>

<p>Mouse monoclonal HAV2C antibody</p>

<p>ARR3 antibody was raised in rabbit using the middle region of ARR3 as the immunogen</p>

<p>KLHL13 antibody was raised in Mouse using a purified recombinant fragment of human KLHL13 expressed in E. coli as the immunogen.</p>

<p>Purified Polyclonal CD295 antibody</p>

<p>Rabbit polyclonal CHST9 antibody</p>

<p>The CD89 antibody is a highly specialized polyclonal antibody that is used in the field of life sciences. It is specifically designed to target and bind to the glial fibrillary acidic protein kinase, which plays a crucial role in various cellular processes. This antibody has been extensively tested and proven to be effective in detecting and quantifying the levels of glial fibrillary acidic protein kinase in various biological samples.</p>

<p>Purified recombinant GLUD1 protein (His tag)</p>

<p>PDGFD antibody was raised using the N terminal of PDGFD corresponding to a region with amino acids NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH</p>

<p>Rat monoclonal CD117 antibody (biotin)</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>Mouse monoclonal LENG1 antibody</p>

<p>The RAB22A antibody is a highly specialized monoclonal antibody that targets the glycan structures found in human serum. This antibody has been extensively studied and has shown promising results in various areas of research, including cancer biology and immunology.</p>

<p>SLC5A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDNGIYNQKFPFKTLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAV</p>

<p>C16ORF48 antibody was raised using the C terminal Of C16Orf48 corresponding to a region with amino acids DLWRREAEARKQSQPDPAMPPGHTRMPENQRLETLTKLLQSQSQLLRELV</p>

<p>MIF protein is a monoclonal antibody that specifically targets and neutralizes the activity of tumor necrosis factor-alpha (TNF-α). This protein has been extensively studied in the field of life sciences and is widely used in research applications. MIF protein is capable of binding to antigenic peptides and can be conjugated with other proteins for various experimental purposes. It has been shown to activate growth factors and inhibit the production of inflammatory cytokines. Additionally, MIF protein can be used in cytotoxic assays or as an electrode for polymerase chain reactions. Its inhibitory factor properties make it a valuable tool in studying angiopoietin-like 3 (ANGPTL3) and other related molecules.</p>

<p>Alkaline phosphatase antibody was raised in mouse using purified human placenta ALP as the immunogen.</p>

<p>Rabbit polyclonal WRKY62 antibody</p>

<p>Rabbit polyclonal VASH1 antibody</p>

<p>Mouse monoclonal RAD51B antibody</p>

<p>The S100P antibody is a monoclonal antibody that targets the protein S100P. S100P is a chemokine-like protein that has been implicated in various biological processes, including cell growth, differentiation, and inflammation. It is also associated with certain diseases, such as circovirus infection and cancer.</p>

<p>Mouse monoclonal C9orf41 antibody</p>

<p>Rabbit polyclonal Retinoblastoma antibody (Ser608)</p>

<p>The ALDOC antibody is a polyclonal antibody that is used in the field of Life Sciences. It specifically targets the ALDOC protein, which is involved in various cellular processes such as chemokine production, acetylation, and natriuretic regulation. This antibody can be used to study the expression and localization of ALDOC in different tissues and cell types.</p>

<p>Chondroadherin antibody was raised using the middle region of CHAD corresponding to a region with amino acids VDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWL</p>

<p>ZNF415 antibody was raised in rabbit using the C terminal of ZNF415 as the immunogen</p>

<p>SLC39A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIESQIQKFMVQNRSASERNSSGDADSAHMEYPYGELIISLGFFFVFFLE</p>

<p>Rabbit polyclonal GPR82 antibody</p>

<p>FGF16 antibody was raised in goat using highly pure recombinant human FGF-16 as the immunogen.</p>

<p>Mouse monoclonal CHEK2 antibody</p>

<p>Mouse monoclonal LT alpha antibody</p>

<p>AP2A1 antibody was raised in rabbit using the C terminal of AP2A1 as the immunogen</p>

<p>KHDRBS1 antibody was raised using the middle region of KHDRBS1 corresponding to a region with amino acids PPPAPETYEEYGYDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSY</p>

<p>SH2B1 antibody was raised using the middle region of SH2B1 corresponding to a region with amino acids GTSFLTRENTDSLELSCLNHSESLPSQDLLLGPSESNDRLSQGAYGGLSD</p>

<p>Rat monoclonal CD11a antibody (PE)</p>

<p>mTORC1/2 inhibitor</p>

<p>Rat monoclonal CD49f antibody (biotin)</p>

<p>Rabbit polyclonal Caspase 9 antibody (Thr125)</p>

<p>CK2 alpha antibody was raised using the C terminal of CSNK2A2 corresponding to a region with amino acids GTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD</p>

<p>Mouse monoclonal UBE2E3 antibody</p>

<p>RAD17 antibody was raised in rabbit using residues 2-15 [NQVTDWVDPSFDDF] of the human RAD17 protein as the immunogen.</p>

<p>Rabbit polyclonal STX8 antibody</p>

<p>Rabbit polyclonal ABL1 antibody (Thr735)</p>

<p>Mouse monoclonal NLN antibody</p>

<p>MCM8 antibody was raised in Rabbit using Human MCM8 as the immunogen</p>

<p>PRMT6 antibody was raised in Mouse using a purified recombinant fragment of human PRMT6 expressed in E. coli as the immunogen.</p>

<p>IL11 antibody was raised in Mouse using recombinant human IL-11 as the immunogen.</p>

<p>EARS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TAKHLLLYQALGWQPPHFAHLPLLLNRDGSKLSKRQGDVFLEHFAADGFL</p>

<p>REEP4 antibody was raised using the N terminal of REEP4 corresponding to a region with amino acids EIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYE</p>

<p>Rabbit polyclonal TBPL1 antibody</p>

<p>ITLN1 antibody was raised in Rabbit using Human ITLN1 as the immunogen</p>

<p>The Hepatitis C Virus protein is a versatile and crucial component in the field of Life Sciences. It plays a significant role in various biological processes, including cell growth, differentiation, and immune response. This protein has been extensively studied for its interactions with other molecules and its impact on human health.</p>

<p>Rat RBC antibody was raised in rabbit using rat erythrocytes as the immunogen.</p>

<p>RPESP antibody was raised using the C terminal of RPESP corresponding to a region with amino acids WMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRC</p>

<p>GIMAP2 antibody was raised in Rabbit using Human GIMAP2 as the immunogen</p>

<p>GLS antibody was raised in Rabbit using Human GLS as the immunogen</p>

<p>Mouse monoclonal NXNL2 antibody</p>

<p>The AID antibody is a monoclonal antibody that has neutralizing properties and specifically targets the HER2 receptor. This antibody binds to the amino group of the HER2 growth factor and inhibits its activity. It can be used in various applications, such as immunohistochemistry, western blotting, and ELISA assays. The AID antibody has been extensively studied in the field of life sciences and has shown promising results in inhibiting tumor growth. It can also be used in combination with other antibodies, such as trastuzumab, to enhance its therapeutic effects. Additionally, this antibody has been shown to have interferon-like activity and can modulate gene expression in nuclear extracts. With its lysine-specific binding capabilities, the AID antibody offers researchers a valuable tool for studying epidermal growth factor signaling pathways and understanding their role in various cellular processes.</p>

<p>Rabbit polyclonal RPL19 antibody</p>

<p>Purified Polyclonal Cotinine 3 Antibody</p>

<p>NET antibody was raised in rabbit using a 22 amino acid peptide of rat NET as the immunogen.</p>

<p>The HOXB4 antibody is a highly specialized monoclonal antibody that acts as an inhibitor of the HOXB4 protein. This protein plays a crucial role in the regulation of hematopoietic stem cell proliferation and differentiation. By targeting and neutralizing the HOXB4 protein, this antibody effectively inhibits its cytotoxic effects and prevents the activation of downstream signaling pathways.</p>

<p>The SOCS3 antibody is a glycoprotein that belongs to the family of antibodies. It is specifically designed to target and bind to a specific antigen, which can be used for various applications in the Life Sciences field. The SOCS3 antibody is a monoclonal antibody, meaning it is produced by a single type of immune cell and has high specificity for its target antigen.</p>

<p>Mouse monoclonal GAS7 antibody</p>

<p>ABHD12 antibody was raised using the middle region of ABHD12 corresponding to a region with amino acids CPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKVQFVPFHSDLGYRH</p>

<p>Rabbit polyclonal RERG antibody</p>

<p>KN-92 is a potassium channel opener that has been shown to increase intracellular calcium levels in cardiac and neuronal cells. It also increases the energy metabolism of cardiac cells by increasing the mitochondrial membrane potential, leading to increased production of ATP. KN-92 has been shown to be effective in experimental models for structural heart disease. It also reduces the incidence of atrial arrhythmia and congestive heart failure in rats with experimentally induced myocardial infarction. KN-92 is not active against granule neurons.</p>

<p>Rabbit polyclonal WIPI2 antibody</p>

<p>LRRC33 antibody was raised using the N terminal of LRRC33 corresponding to a region with amino acids GLERLRELDLQRNYIFEIEGGAFDGLAELRHLNLAFNNLPCIVDFGLTRL</p>

<p>SLC25A24 antibody was raised using a synthetic peptide corresponding to a region with amino acids FLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLA</p>

<p>Rabbit polyclonal ALK antibody (Tyr1507)</p>

<p>SUPT16H antibody was raised in rabbit using the N terminal of SUPT16H as the immunogen</p>

<p>Purified Polyclonal ATP8 antibody</p>

<p>Mouse monoclonal KRT18 antibody</p>

<p>Rabbit polyclonal SH3BP1 antibody</p>

<p>The GUF1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and binds to the apical membrane of cells, allowing for precise detection and analysis. This antibody recognizes and interacts with specific tyrosine residues on growth factor receptors, providing valuable insights into signaling pathways and cellular responses.</p>

<p>AXUD1 antibody was raised in rabbit using human AXUD1 protein as the immunogen.</p>

<p>Mouse monoclonal OTUB2 antibody</p>

<p>Mouse monoclonal DLD antibody</p>

<p>The Caspase 9 antibody is a highly specialized polyclonal antibody that targets the caspase 9 enzyme involved in apoptosis. It plays a crucial role in regulating cell death and is essential for maintaining tissue homeostasis. This antibody has been extensively studied in the field of life sciences and has shown promising results in various research areas.</p>

<p>Rabbit polyclonal UPF3A antibody</p>

<p>The REN antibody is a highly specialized monoclonal antibody that targets the hepatocyte growth factor and chemokine receptor CXCR4. It acts as a potent family kinase inhibitor, blocking the signaling pathways involved in cell growth and migration. This colloidal antibody has been extensively studied in the field of life sciences and has shown promising results in inhibiting tumor growth and metastasis. Additionally, it has been found to have nephrotoxic effects, making it a potential therapeutic option for kidney-related disorders. The REN antibody is also used in research settings to detect autoantibodies and cytotoxic antibodies, as well as for studying thrombocytopenia. With its diverse applications and high efficacy, this antibody is an invaluable tool for scientists and researchers in various fields of study.</p>

<p>Mouse monoclonal BEST3 antibody</p>

<p>Rabbit polyclonal HMMR antibody</p>

<p>The PDLIM2 antibody is a highly specific monoclonal antibody that is used in various life science assays. It is designed to detect and bind to the PDLIM2 protein, which plays a crucial role in regulating cell proliferation, differentiation, and apoptosis. This antibody has been extensively validated for its high affinity and specificity, making it an ideal tool for researchers studying the function of PDLIM2 in different biological systems.</p>

<p>HSPA1A antibody was raised in Rabbit using Human HSPA1A as the immunogen</p>

<p>Rabbit polyclonal UGT8 antibody</p>

<p>NPFF2 antibody was raised in rabbit using N terminal sequence MNEKWDTNSSENWHPI and C terminal sequence ELVMEELKETTNSSEI of the human NPFF2 protein as the immunogen.</p>

<p>Mouse monoclonal PACSIN3 antibody</p>

<p>Armenian Hamster monoclonal CD61 antibody (FITC)</p>

<p>KLK11 antibody was raised in rabbit using residues 68-82 [YIVHLGQHNLQKEEG] of the 35 kDa human hippostasin/KLK11protein as the immunogen.</p>

<p>ZMYND11 antibody was raised in rabbit using the N terminal of ZMYND11 as the immunogen</p>

<p>1-207 amino acids: MGSSHHHHHH SSGLVPRGSH MDKDCEMKRT TLDSPLGKLE LSGCEQGLHE IKLLGKGTSA ADAVEVPAPA AVLGGPEPLM QCTAWLNAYF HQPEAIEEFP VPAFHHPVFQ QESFTRQVLW KLLKVVKFGE VISYQQLAAL AGNPKAARAV GGAMRGNPVP ILIPCHRVVC SSGAVGNYSG GLAVKEWLLA HEGHRLGKPG LGGSSGLAGA WLKGAGATSG SPPAGRN</p>

<p>Hexokinase antibody was raised in mouse using recombinant human Hexokinase1 (1-917aa) purified from E. coli as the immunogen.</p>

<p>Digitoxin antibody was raised in rabbit using digitoxin-BSA as the immunogen.</p>

<p>ERK1 antibody was raised in mouse using recombinant full length ERK1 protein as the immunogen.</p>

<p>Rabbit polyclonal KRBP antibody</p>

<p>Matrilin 3 antibody was raised using the middle region of MATN3 corresponding to a region with amino acids IELYAVGVDRADMASLKMMASEPLEEHVFYVETYGVIEKLSSRFQETFCA</p>

<p>The SIGLEC9 antibody is a monoclonal antibody that is used in immunoassays to detect autoantibodies in human serum. It can be immobilized on an electrode and used for the quantitation of specific markers or proteins. This antibody has anti-angiogenesis properties, making it valuable in research and potential treatment and/or prophylaxis of angiogenesis-related conditions. The SIGLEC9 antibody can be used in combination with streptavidin or other detection methods to enhance sensitivity and specificity in various life science applications. Its high affinity for histidine makes it an excellent tool for protein purification and analysis.</p>

<p>1-162 amino acids: MGSSHHHHHH SSGLVPRGSH MPRADCIMRH LPYFCRGQVV RGFGRGSKQL GIPTANFPEQ VVDNLPADIS TGIYYGWASV GSGDVHKMVV SIGWNPYYKN TKKSMETHIM HTFKEDFYGE ILNVAIVGYL RPEKNFDSLE SLISAIQGDI EEAKKRLELP EHLKIKEDNF FQVSKSKIMN GH</p>