Bioquímicos e reagentes

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMPRSS3 antibody, catalog no. 70R-3257</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIF25 antibody, catalog no. 70R-1615</p>

<p>VPS16 antibody was raised in rabbit using the middle region of VPS16 as the immunogen</p>

<p>Rabbit polyclonal NCoA2 antibody</p>

<p>Purified Polyclonal SHPTP2 antibody</p>

<p>Lysozyme protein is a versatile enzyme that plays a crucial role in various biological processes. It acts as an epidermal growth factor and hormone peptide, contributing to cell proliferation and differentiation. Lysozyme also exhibits neuroprotective properties by preventing the accumulation of dopamine, which can lead to neuronal damage when activated excessively.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf104 antibody, catalog no. 70R-3998</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RXRG antibody, catalog no. 70R-1925</p>

<p>PAXIP1 antibody was raised in rabbit using the N terminal of PAXIP1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF227 antibody, catalog no. 70R-8165</p>

<p>Region of Noggin protein corresponding to amino acids MQHYLHIRPA PSDNLPLVDL IEHPDPIFDP KEKDLNETLL RSLLGGHYDP GFMATSPPED RPGGGGGPAG GAEDLAELDQ LLRQRPSGAM PSEIKGLEFS EGLAQGKKQR LSKKLRRKLQ MWLWSQTFCP VLYAWNDLGS RFWPRYVKVG SCFSKRSCSV PEGMVCKPSK SVHLTVLRWR CQRRGGQRCG WIPIQYPIIS ECKCSC.</p>

<p>CCDC7 antibody was raised using the N terminal of CCDC7 corresponding to a region with amino acids KHNAKLIHDKIEPMVLRSPPTGESILRYALPIPSSKTKNLLPEDEMIGKI</p>

<p>ADAD2 antibody was raised using the C terminal of ADAD2 corresponding to a region with amino acids TPDTCRGLSLNWSLGDPGIEVVDVATGRVKANAALGPPSRLCKASFLRAF</p>

<p>The Fibronectin antibody is an antigen binding molecule that specifically targets fibronectin, a protein involved in cell adhesion and migration. It has been shown to inhibit the activation of tyrosine kinase receptors and block the binding of fibronectin to its receptors on cells. This antibody can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry to study the biological effects of fibronectin in different tissues and cell types.</p>

<p>RAB9A antibody was raised in rabbit using the middle region of RAB9A as the immunogen</p>

<p>ANO3 antibody was raised in Rabbit using Human ANO3 as the immunogen</p>

<p>Lipase J antibody was raised using the C terminal of LIPJ corresponding to a region with amino acids LNLVHYNQTTSPLYNMTNMNVATAIWNGKSDLLADPEDVNILHSEITNHI</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GIMAP1 antibody, catalog no. 70R-6386</p>

<p>CGP 78608 is a neuropeptide Y (NPY) Y5 receptor antagonist, which is a synthetic compound derived from a complex series of chemical syntheses. The source of this product lies in tailored organic chemistry processes designed to precisely inhibit specific receptor subtypes associated with neuropeptide Y.</p>

<p>Rabbit polyclonal TF3B antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CLDN15 antibody, catalog no. 70R-1688</p>

<p>COPS4 antibody was raised in Rabbit using Human COPS4 as the immunogen</p>

<p>ANGPTL7 antibody was raised in Rabbit using Human ANGPTL7 as the immunogen</p>

<p>The KLK1 antibody is a polyclonal antibody that is used in life sciences research. It is designed to target and neutralize the effects of acetylcholine, interferon, chemokine, and other molecules involved in intraocular endothelial growth. This antibody has been shown to be effective in blocking the activity of these molecules, thereby inhibiting their effects on cell growth and function. Additionally, the KLK1 antibody can be used to detect the presence of autoantibodies or test compounds in biological samples. Its high specificity and affinity make it an essential tool for researchers studying growth factors and their role in various physiological processes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMED3 antibody, catalog no. 70R-1897</p>

<p>ApoE protein is a key player in various biological processes and has significant implications in the field of Life Sciences. It is a low-molecular-weight protein that plays a crucial role in the regulation of cell growth, development, and repair. ApoE protein interacts with various receptors, including TGF-beta, streptavidin, transferrin, and epidermal growth factor (EGF)-like proteins.</p>

<p>Prr16 antibody was raised in rabbit using the N terminal of Prr16 as the immunogen</p>

<p>RERG antibody was raised in rabbit using the C terminal of RERG as the immunogen</p>

<p>Tacrolimus 32 Conjugate for use in immunoassays</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Omp antibody, catalog no. 70R-9418</p>

<p>The p90RSK antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the antigen binding domain of the p90RSK protein, which plays a crucial role in various cellular processes. This antibody is commonly used in experiments involving electrode and flow assays to study the function and activity of p90RSK.</p>

<p>The STAT1 antibody is a highly specialized monoclonal antibody that targets the signal transducer and activator of transcription 1 (STAT1) protein. This antibody is commonly used in life sciences research to study various cellular processes, including growth factor signaling, insulin regulation, and immune responses.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPATA24santibody, catalog no. 70R-4050</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CHRNA3 antibody, catalog no. 70R-5188</p>

<p>Rabbit polyclonal Cytokeratin 18 antibody (Ser52)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STAT5B antibody, catalog no. 20R-1134</p>

<p>Rabbit polyclonal ZNF337 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SOHLH1 antibody, catalog no. 70R-4217</p>

<p>WNT9B antibody was raised using the middle region of WNT9B corresponding to a region with amino acids CTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSKRGNKDLRARADA</p>

<p>BRMS1L antibody was raised in rabbit using the C terminal of BRMS1L as the immunogen</p>

<p>The Bt Cry2Ab protein is a highly versatile antibody that finds applications in various fields of Life Sciences. It is widely used in research laboratories as an electrode for studying the effects of different compounds on cell signaling pathways. Additionally, this protein has been shown to stimulate colony formation and growth factor production, making it a valuable tool in the study of colony-stimulating factors.</p>

<p>Factor IX antigen Matched Pair antibody Set for ELISA</p>

<p>Purified Polyclonal MMP11 antibody</p>

<p>The CD325 antibody is a highly specialized monoclonal antibody that targets β-catenin, a protein involved in cell adhesion and signaling pathways. It is commonly used in life sciences research to study the role of β-catenin in various cellular processes. The CD325 antibody specifically recognizes the non-phosphorylated form of β-catenin, allowing for precise detection and analysis.</p>

<p>alpha 2 Antiplasmin antibody was raised in goat using human alpha 2 Antiplasmin purified from plasma as the immunogen.</p>

<p>The SMUG1 antibody is a highly specific and potent antibody that can be used in various applications in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, providing researchers with flexibility in their experimental design.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MDS032 antibody, catalog no. 70R-8339</p>

<p>GPHN antibody was raised in Rabbit using Human GPHN as the immunogen</p>

<p>MKNK1 antibody was raised in rabbit using the C terminal of MKNK1 as the immunogen</p>

<p>DNAJB8 antibody was raised in Rabbit using Human DNAJB8 as the immunogen</p>

<p>Chlorpromazine Conjugate for use in immunoassays</p>

<p>SPC25 antibody was raised in rabbit using the middle region of SPC25 as the immunogen</p>

<p>RANBP5 antibody was raised in rabbit using the N terminal of RANBP5 as the immunogen</p>

<p>Purified Rabbit polyclonal ELSPBP1 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bacterial growth. This bactericidal activity is achieved by inhibiting DNA-dependent RNA polymerase, which hinders transcription and replication processes essential for bacterial survival. The effectiveness of this drug has been confirmed through extensive testing using advanced techniques such as patch-clamp on human erythrocytes. Additionally, its metabolic transformations include hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains and effectively impedes their growth in culture.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF17 antibody, catalog no. 70R-8174</p>

<p>MIPOL1 antibody was raised in Rabbit using Human MIPOL1 as the immunogen</p>

<p>The CD70 antibody is a potent antitumor agent that has been shown to inhibit the growth of tumors by reducing microvessel density and suppressing endothelial cell growth. This monoclonal antibody specifically targets the CD70 receptor, which is overexpressed in various cancer cells. By binding to this receptor, the CD70 antibody exerts cytotoxic effects on tumor cells, leading to their destruction.</p>

<p>The MMP13 antibody is a highly specific monoclonal antibody that targets and inhibits the activity of matrix metalloproteinase 13 (MMP13). MMP13 is an enzyme involved in the breakdown of extracellular matrix components, such as collagen, and plays a crucial role in tissue remodeling and wound healing. This antibody binds to MMP13 with high affinity, effectively blocking its enzymatic activity.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GRM6 antibody, catalog no. 70R-7886</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FIP1L1 antibody, catalog no. 70R-4866</p>

<p>The HSP27 antibody is a highly specialized tool used in Life Sciences research. It is designed to target and bind to the Heat Shock Protein 27 (HSP27), a protein involved in cellular stress response and regulation. This antibody can be used in various applications, such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA).</p>

<p>TNFSF15 antibody is a polyclonal antibody that targets TNFSF15, a member of the tumor necrosis factor (TNF) ligand superfamily. It plays a crucial role in immune regulation and inflammation. This antibody can bind to TNFSF15 and inhibit its activity, preventing it from binding to its receptor and initiating downstream signaling pathways. TNFSF15 antibody has been shown to have lysis activity against target cells expressing TNFSF15, making it a potential therapeutic option for conditions associated with TNFSF15 overexpression. Additionally, this antibody can be used in research applications such as western blotting, immunohistochemistry, and flow cytometry to detect and quantify TNFSF15 expression levels. With its high specificity and sensitivity, TNFSF15 antibody is a valuable tool for studying the function of TNFSF15 in various biological processes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SBDS antibody, catalog no. 70R-1181</p>

<p>Affinity purified Rabbit polyclonal RBMY1A1 antibody</p>

<p>The HDAC7 antibody is a polyclonal antibody that specifically targets and neutralizes the activity of HDAC7, a protein involved in various cellular processes. This antibody has been extensively studied and proven to effectively inhibit the activation of TGF-beta, a growth factor that plays a crucial role in cell proliferation and differentiation. By blocking the activity of HDAC7, this antibody prevents the formation of a protein complex that is essential for TGF-beta signaling. Additionally, the HDAC7 antibody has been shown to have inhibitory effects on the expression of androgen-regulated proteins such as ferritin and mucin. With its potent neutralizing properties, this antibody is widely used in life sciences research as well as in the development of novel therapeutic inhibitors targeting HDAC7.</p>

<p>Affinity purified Rabbit polyclonal SUCLA2 antibody</p>

<p>Purified Polyclonal NDUFA8 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infections. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Through various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, it is metabolized into oxidative metabolites. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits cell growth in culture. With its potent properties and mechanisms of action, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective choice for treating tuberculosis infections.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PLP1 antibody, catalog no. 70R-6999</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Arpc4 antibody, catalog no. 70R-7971</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>Purified recombinant Human NUDT16L1 protein</p>

<p>Rabbit polyclonal MRPL10 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PNPLA3 antibody, catalog no. 70R-2371</p>

<p>Rabbit polyclonal VTCN1 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SNRP70 antibody, catalog no. 70R-1431</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WT1 antibody, catalog no. 70R-8233</p>

<p>Region of IGF BP6 protein corresponding to amino acids RCPGCGQGVQ AGCPGGCVEE EDGGSPAEGC AEAEGCLRRE GQECGVYTPN CAPGLQCHPP KDDEAPLRAL LLGRGRCLPA RAPAVAEENP KESKPQAGTA RPQDVNRRDQ QRNPGTSTTP SQPNSAGVQD TEMGPCRRHL DSVLQQLQTE VYRGAQTLYV PNCDHRGFYR KRQCRSSQGQ RRGPCWCVDR MGKSLPGSPD GNGSSSCPTG SSG.</p>

<p>Mouse anti Human IgG secondary antibody (Poly-HRP80)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DYNC1I1 antibody, catalog no. 70R-4124</p>

<p>STK16 antibody was raised using the middle region of STK16 corresponding to a region with amino acids TDVWSLGCVLYAMMFGEGPYDMVFQKGDSVALAVQNQLSIPQSPRHSSAL</p>

<p>Affinity purified Sheep polyclonal BSA antibody (HRP)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAP4K4 antibody, catalog no. 70R-5785</p>

<p>UFM1 antibody was raised in rabbit using the middle region of UFM1 as the immunogen</p>

<p>Rabbit polyclonal MARK3 antibody</p>

<p>Rabbit polyclonal Heparin Cofactor II antibody</p>

<p>Neurocan Monoclonal Antibody</p>

<p>Purified recombinant Human ALAD Protein (His tag)</p>

<p>Rabbit polyclonal VOPP1 antibody (HRP)</p>

<p>Custom research peptide; min purity 95%.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MPPED2 antibody, catalog no. 70R-5251</p>

<p>This antibody reacts with heavy (gamma) chains on sheep IgG and light chains on all sheep immunoglobulins.</p>

<p>Donkey anti-mouse IgG (H + L) (Alk Phos) was raised in donkey using mouse IgG (H&amp;L) as the immunogen.</p>

<p>Rabbit Polyclonal p27Kip1 antibody (Thr187)</p>

<p>Purified Polyclonal MDH1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of POLDIP3 antibody, catalog no. 70R-4847</p>

<p>The cSRC antibody is a highly specialized biomarker used in life sciences research. It is a polyclonal antibody that specifically targets the reductase enzyme, which plays a crucial role in various cellular processes. This antibody has been extensively studied and validated for its high specificity and sensitivity. It has been shown to effectively detect and quantify the expression levels of reductase in different cell types.</p>

<p>Rabbit polyclonal GRP78 antibody (FITC)</p>

<p>RAB2B antibody was raised in rabbit using the C terminal of RAB2B as the immunogen</p>