Bioquímicos e reagentes

<p>The 1-morpholino-1-(thiophen-2-yl)propane-2-yl)-3-(2-(trifluoromethoxy)phenyl)thiourea (MTT) is a research tool, which is used as an activator, ligand, receptor or cell biology. It has been shown to inhibit ion channels and cause changes in the properties of protein interactions. The MTT has also been shown to be an inhibitor of peptides.</p>

<p>PF 04628935 is a ghrelin receptor antagonist. It has been shown to have serotonergic, neuroprotective and neurogenic effects. PF 04628935 has been shown to regulate the release of neurotransmitters in the brain, which may be due to its ability to inhibit the binding of serotonin to 5-HT1A receptors. It also has an effect on the central nervous system by activating serotonergic receptors in the brain and inhibiting their deactivation by serotonin. This drug also has neuroprotective activity, as it can neutralize reactive oxygen species and prevent lipid peroxidation. PF 04628935 blocks 5-HT2A receptors with selectivity, preventing activation of these receptors by serotonin and antagonizing hallucinogenic effects caused by drugs such as LSD or psilocybin. This drug also inhibits 5-HT7 receptors, which may contribute to its effects on mood regulation and appetite suppression.</p>

<p>ML348 is a chemical compound that functions as a potent MDM2 antagonist, which originates from advanced medicinal chemistry research focused on cancer therapeutics. MDM2 is a primary negative regulator of the tumor suppressor protein p53, and ML348 disrupts the interaction between MDM2 and p53, thereby enhancing p53's tumor-suppressing activities.</p>

<p>(2,5-Dioxopyrrolidin-1-yl) 4-[4-[4-(2,5-dioxopyrrolidin-1-yl)oxy-4-oxobutyl]-1,4-diazoniabicyclo[2.2.2]octan-1-yl]butanoate, dibromide is a chemical compound that functions as a bifunctional cross-linking agent. It is synthesized through the reaction of specific amine and carboxylic acid compounds under controlled conditions. The compound features N-hydroxysuccinimide esters and quaternary diazabicyclooctane groups, enhancing its reactivity and solubility.</p>

<p>M 1145 is a monoclonal antibody, which is derived from a highly specific and engineered immunoglobulin source. Its mode of action involves targeting and modulating specific immune cell receptors, disrupting signaling pathways that are critical for the activation and proliferation of these cells. As a result, it can effectively modulate immune responses, making it a promising candidate for therapeutic applications in autoimmune diseases and certain types of cancers.</p>

<p>Rabbit polyclonal ELOA2 antibody</p>

<p>PTCH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAM</p>

<p>Rat monoclonal CD244.2 antibody (FITC)</p>

<p>Purified recombinant EXOSC3 protein (His tag)</p>

<p>Az7550 hydrochloride is a research tool for the study of ion channels and receptor interactions. It is a ligand that binds to the peptide receptor site on the cell membrane and activates the channel, leading to an influx of ions into the cell. Az7550 hydrochloride has been shown to activate potassium channels by binding to their ligand-binding site.<br>Az7550 hydrochloride has also been used as an antibody labeling agent for immunofluorescence staining.</p>

<p>Rabbit polyclonal ZAP70 antibody (Tyr493)</p>

<p>PDK3 antibody was raised using the middle region of PDK3 corresponding to a region with amino acids IYLKALSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAK</p>

<p>LRRC24 antibody was raised using the N terminal of LRRC24 corresponding to a region with amino acids PLAALRRLYLHNNSLRALEAGAFRAQPRLLELALTSNRLRGLRSGAFVGL</p>

<p>IRS1 antibody was raised in Rabbit using Human IRS1 as the immunogen</p>

<p>KIAA0692 antibody was raised using the middle region of Kiaa0692 corresponding to a region with amino acids CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG</p>

<p>Rabbit polyclonal TCEAL3 antibody</p>

<p>The Albumin antibody is a powerful tool for researchers working with human albumin. This monoclonal antibody specifically targets and binds to albumin, allowing for precise detection and analysis. It can be used in various applications, including immunohistochemistry, Western blotting, and ELISA.</p>

<p>Purified Polyclonal GRLF1 antibody</p>

<p>Rabbit polyclonal NFKB1 antibody (biotin)</p>

<p>Rabbit polyclonal TAC1 antibody</p>

<p>Purified Polyclonal cJun antibody</p>

<p>AZD9977 is a peptide that has been shown to inhibit the activity of a number of proteins, including protein interactions, activator and ligand. It is also an inhibitor for CAS No. 1850385-64-6 and has been shown to be a research tool for studying the function of ion channels and receptors. The antibody has been used to study the localization of ion channels in rat hippocampal neurons. AZD9977 is also an inhibitor for CAS No. 1850385-64-6 with high purity and is a useful reagent for life sciences as well as high quality research tools.</p>

<p>Rabbit polyclonal CSFR antibody (Tyr809)</p>

<p>Mouse monoclonal HSPA6 antibody</p>

<p>Purified Polyclonal TNFAIP1 antibody</p>

<p>ANTXR1 antibody was raised using the middle region of ANTXR1 corresponding to a region with amino acids VRWGEKGSTEEGAKLEKAKNARVKMPEQEYEFPEPRNLNNNMRRPSSPRK</p>

<p>Mouse monoclonal HLADQ antibody</p>

<p>1-339 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMST VHEILCKLSL EGDHSTPPSA YGSVKAYTNF DAERDALNIE TAIKTKGVDE VTIVNILTNR SNAQRQDIAF AYQRRTKKEL ASALKSALSG HLETVILGLL KTPAQYDASE LKASMKGLGT DEDSLIEIIC SRTNQELQEI NRVYKEMYKT DLEKDIISDT SGDFRKLMVA LAKGRRAEDG SVIDYELIDQ DARDLYDAGV KRKGTDVPKW ISIMTERSVP HLQKVFDRYK SYSPYDMLES IRKEVKGDLE NAFLNLVQCI QNKPLYFADR LYDSMKGKGT RDKVLIRIMV SRSEVDMLKI RSEFKRKYGK SLYYYIQQDT KGDYQKALLY LCGGDD</p>

<p>Purified recombinant PHGDH protein (His tag)</p>

<p>Purified recombinant RPL26L1 protein (His tag)</p>

<p>The SQSTM1 antibody is a monoclonal antibody that specifically targets and binds to SQSTM1 protein. This protein plays a crucial role in various cellular processes, including macrophage inflammatory responses, antigen presentation, and autophagy regulation. The SQSTM1 antibody can be used in bioassays to detect and measure the levels of SQSTM1 protein in different samples.</p>

<p>UBE2K antibody was raised using a synthetic peptide corresponding to a region with amino acids QTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSWDVET</p>

<p>BCAS2 antibody was raised using the N terminal of BCAS2 corresponding to a region with amino acids MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYL</p>

<p>RBPJ antibody is a highly specific and potent inhibitor of the RBPJ protein. RBPJ is a transcription factor that plays a crucial role in various cellular processes, including development, differentiation, and immune response. This antibody binds to RBPJ with high affinity, preventing its interaction with DNA and inhibiting its transcriptional activity.</p>

<p>Clenbuterol OVA is a unique product in the field of Life Sciences. It is a mitochondrial superoxide that has been conjugated with Hapten to create a powerful cell antigen. This reactive compound can be used in various research applications, and its properties have been extensively studied. Clenbuterol OVA is recognized by a specific monoclonal antibody, which has neutralizing capabilities. Researchers can utilize this product for the development of Proteins and Antigens, as well as for studying electrode growth factors and chemokines. Additionally, Clenbuterol OVA has shown promising results in hepatocyte growth studies. With its high specificity and reliability, this product is an essential tool for any researcher in the field.</p>

<p>Rabbit polyclonal rPSB antibody (biotin)</p>

<p>Purified recombinant RHOV protein (His tag)</p>

<p>Purified Polyclonal CD167a antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF431 antibody, catalog no. 70R-8406</p>

<p>Chlamydia trachomatis antibody was raised in goat using L2 and other serovar groups as the immunogen.</p>

<p>Purified recombinant FHL3 protein (His tag)</p>

<p>The CrkL antibody is an essential tool in the field of Life Sciences. It is a versatile antibody that can be used for various applications, such as research and diagnostics. This antibody specifically targets CrkL, a protein known to play a crucial role in cell signaling pathways.</p>

<p>Mouse monoclonal Benzoylecgonine/Cocaine antibody</p>

<p>Rabbit polyclonal ZAP70 antibody (Tyr315)</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAVER2 antibody, catalog no. 70R-4637</p>

<p>C21ORF13 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSEEPLQSKESHPLPPSQASTSHAFGDSKVTVVNSIKPSSPTEGKRKIII</p>

<p>Purified recombinant HS3ST1 protein (His tag)</p>

<p>Purified Polyclonal NGEP antibody</p>

<p>Purified Polyclonal GSTM1 antibody</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>Mouse monoclonal BCAR1 antibody</p>

<p>Rabbit polyclonal ISG15 antibody (HRP)</p>

<p>Tetraspanin 1 antibody was raised using the middle region of TSPAN1 corresponding to a region with amino acids TMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKA</p>

<p>Purified Polyclonal Lamin A/C antibody</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>Rabbit polyclonal TMOD4 antibody</p>

<p>LIN7C antibody was raised using a synthetic peptide corresponding to a region with amino acids MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAV</p>

<p>SMC3 antibody was raised in Rat using Mouse SMC3 and GST fusion protein as the immunogen.</p>

<p>PCSK5 antibody was raised using the middle region of PCSK5 corresponding to a region with amino acids CAGAGADGCINCTEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDIS</p>

<p>Mouse serum albumin antibody was raised in goat using mouse serum albumin as the immunogen.</p>

<p>The TEX14 antibody is a protein that acts as a growth factor, specifically targeting epidermal growth factor and hepatocyte growth inhibitory factor. It is an essential component in the field of Life Sciences and is widely used in research studies. The TEX14 antibody can be utilized as both a monoclonal and polyclonal antibody, making it versatile for various applications. Its high specificity allows for accurate detection and analysis of c-myc expression levels. Additionally, the TEX14 antibody has been found to be effective in detecting autoantibodies, making it valuable in diagnostic testing. With its robust capabilities, this antibody is an indispensable tool for researchers in the field.</p>

<p>Purified Polyclonal Kv9.2 antibody</p>

<p>The Fn14 antibody is a specific antiserum that has chemotactic activity and can target opioid peptides. It is a monoclonal antibody that is widely used in the field of Life Sciences. The Fn14 antibody has been shown to inhibit androgen biosynthesis, making it a valuable tool in research related to hormone regulation. This antibody specifically binds to the antigen binding domain of Fn14, a protein involved in various cellular processes. It has also been used in studies on steroid metabolites and pleomorphic adenoma. Additionally, the Fn14 antibody can be conjugated to a carbon electrode for electrochemical detection methods, such as phenyl phosphate assays.</p>

<p>Parainfluenza type 3 antibody was raised in mouse using parainfluenza virus, type 3 as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. With its bactericidal activity, it effectively treats tuberculosis infections. This active compound inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. Metabolized through various transformations, including hydrolysis, oxidation, reduction, and conjugation, this drug specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Rabbit polyclonal TMEM120A antibody</p>

<p>ARF6 antibody was raised using the middle region of ARF6 corresponding to a region with amino acids REMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSG</p>

<p>The CD4 antibody is a highly specific monoclonal antibody that targets the CD4 protein, which is expressed on the surface of certain immune cells. This antibody has been extensively studied and has shown various biological effects. It has been found to inhibit syncytia formation, a process in which infected cells fuse together to form giant multinucleated cells. Additionally, the CD4 antibody can block the interaction between CD4 and its ligands, such as the IL-2 receptor, thereby modulating immune responses.</p>

<p>HSP90B1 antibody was raised in Rabbit using Human HSP90B1 as the immunogen</p>

<p>Goat anti-human kappa chain (Fab'2) (FITC) was raised in goat using human kappa light chain as the immunogen.</p>

<p>FSH protein is a multifunctional protein with various characteristics. It acts as a natriuretic factor, promoting the excretion of sodium in the kidneys. Additionally, it functions as a growth factor and chemokine, playing a role in cell proliferation and migration. FSH protein is widely used in research and diagnostic applications as it can be used to generate neutralizing antibodies for various studies. The amino-terminal of FSH protein has been found to have specific binding properties with human serum, making it an essential component in the production of recombinant proteins and antigens. FSH protein can exist in both activated and dimers forms, allowing for different physiological functions depending on its conformation. It has also shown potential therapeutic effects in conditions such as TNF-α-induced inflammation and creatine kinase-related disorders. Researchers often utilize polyclonal and monoclonal antibodies targeting FSH protein to study its expression patterns and biological functions.</p>

<p>The cRel antibody is a monoclonal antibody that specifically targets the nuclear factor cRel. This protein plays a crucial role in various cellular processes, including the regulation of gene expression and immune responses. The cRel antibody can be used in a variety of assays to study the function and localization of this protein. Additionally, it has been shown to have potential therapeutic applications in the field of life sciences. By targeting cRel, this antibody may help researchers gain valuable insights into diseases such as cancer, autoimmune disorders, and inflammatory conditions. Its high specificity and affinity make it a valuable tool for scientists working in the field of molecular biology and immunology.</p>

<p>TMEM9 antibody was raised using the C terminal of TMEM9 corresponding to a region with amino acids DARSMAAAAASLGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS</p>

<p>HPD antibody was raised using the middle region of HPD corresponding to a region with amino acids EMIDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIV</p>

<p>Rabbit polyclonal Cytochrome P450 39A1 antibody</p>

<p>Purified recombinant PMF1-BGLAP protein (His tag)</p>

<p>The TGF alpha antibody is a highly effective monoclonal antibody that is used in Life Sciences research. It has been shown to neutralize the activity of TGF-alpha, a potent chemokine that plays a crucial role in cell growth and development. This antibody binds to TGF-alpha and prevents it from activating its receptors, thereby inhibiting downstream signaling pathways. The TGF alpha antibody is colloidal in nature, allowing for easy and efficient delivery into cells. It can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. Additionally, this antibody has been found to have potential therapeutic applications in diseases involving abnormal TGF-alpha signaling, such as certain types of cancer and neurodegenerative disorders. Its high specificity and affinity make it an invaluable tool for researchers studying the role of TGF-alpha in various biological processes.</p>

<p>Rabbit polyclonal RGS14 antibody</p>

<p>Rabbit polyclonal TNR antibody</p>

<p>Purified recombinant B9D1 protein (His tag)</p>

<p>ZNF326 antibody was raised in rabbit using the N terminal of ZNF326 as the immunogen</p>

<p>The ANTXR1 antibody is a highly specific monoclonal antibody used in Life Sciences research. It targets the ANTXR1 protein, which plays a crucial role in collagen metabolism and liver microsome function. This antibody can be utilized in various applications such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). It has been proven to be effective in identifying and quantifying ANTXR1 expression levels in different cell types and tissues.</p>

<p>Rabbit polyclonal CDC25A antibody (Thr507)</p>

<p>MPZL1 antibody was raised using the middle region of MPZL1 corresponding to a region with amino acids ISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVE</p>

<p>FGF21 protein is a growth factor that plays a crucial role in various biological processes. It acts as a chemokine and has anti-VEGF (vascular endothelial growth factor) properties, making it an important molecule for regulating endothelial growth. FGF21 protein is widely used in the field of Life Sciences, particularly in research related to adipose tissue and metabolic disorders.</p>

<p>UFD1L antibody was raised in rabbit using the middle region of UFD1L as the immunogen</p>

<p>MAP4K5 antibody was raised using the middle region of MAP4K5 corresponding to a region with amino acids QGKSFKSDEVTQEISDETRVFRLLGSDRVVVLESRPTENPTAHSNLYILA</p>

<p>Purified Polyclonal IKK beta antibody</p>

<p>Mouse monoclonal SPTAN1 antibody</p>

<p>Mouse monoclonal MAB21L3 antibody</p>

<p>Rat monoclonal Integrin beta 7 antibody (biotin)</p>

<p>The QSOX1 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that can neutralize the activity of QSOX1, an enzyme involved in the formation of disulfide bonds in proteins. This antibody recognizes a conformational epitope on QSOX1 and inhibits its function as a topoisomerase inhibitor.</p>

<p>TNKS1BP1 antibody was raised using the middle region of TNKS1BP1 corresponding to a region with amino acids DGEASQTEDVDGTWGSSAARWSDQGPAQTSRRPSQGPPARSPSQDFSFIE</p>

<p>Rabbit polyclonal VATPase G1 antibody (FITC)</p>

<p>MBD5 antibody was raised in Rabbit using Human MBD5 as the immunogen</p>

<p>Mouse monoclonal HSD17B10 antibody</p>

<p>Mouse monoclonal BUB1B antibody</p>

<p>The CYP2J2 antibody is a highly specialized monoclonal antibody that targets β-catenin, a key protein involved in cell adhesion and signaling pathways. This antibody specifically inhibits the activation of chemokine receptors, which are important for immune cell recruitment and inflammation. It has been extensively studied as a potential therapeutic target for various diseases, including cancer and cardiovascular disorders.</p>

<p>Cefmetazole (USP grade powder) chemical reference substance</p>