Bioquímicos e reagentes

<p>LRRC8B antibody was raised using the N terminal of LRRC8B corresponding to a region with amino acids PSTSSRLEHFVAILHKCFDSPWTTRALSETVAEQSVRPLKLSKSKILLSS</p>

<p>Rabbit polyclonal H3F3B antibody (Ser31)</p>

<p>Purified homogeneous preparation of Streptavidin protein conjugated to 40nm colloidal gold in solution</p>

<p>Goat anti-rabbit IgG (H+L) (Fab'2) (FITC) was raised in goat using rabbit IgG whole molecule as the immunogen.</p>

<p>Rabbit polyclonal PDIA3 antibody (biotin)</p>

<p>Purified recombinant GNRH1 protein (His tag)</p>

<p>Rabbit polyclonal CLDN8 antibody</p>

<p>The VEGFR1 antibody is a monoclonal antibody that specifically targets the vascular endothelial growth factor receptor 1 (VEGFR1). It has been extensively studied and shown to have a high affinity for VEGFR1, making it an effective tool for research in the field of life sciences. This antibody can be used in various applications, including immunohistochemistry, flow cytometry, and western blotting.</p>

<p>The Fibrinogen antibody is a powerful growth factor that promotes endothelial growth. It has been found to have neutralizing effects on Helicobacter, as well as alpha-fetoprotein, anti-VEGF, erythropoietin, and fibrinogen. This antibody is particularly effective in treating conditions such as heparin-induced thrombocytopenia and natriuretic disorders. It works by inhibiting the action of calmodulin and other inhibitors, allowing for better regulation of blood clotting and platelet function. The Fibrinogen antibody is a monoclonal antibody that can be used in various medical applications, including electrode-based assays. With its diverse range of therapeutic properties, this antibody is an essential tool in modern medicine.</p>

<p>Purified recombinant CSF2RA protein (His tag)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been demonstrated through a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Mouse monoclonal IgM antibody (FITC)</p>

<p>ME3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGPARPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQD</p>

<p>Purified recombinant SYT5 protein (His tag)</p>

<p>CRTAP antibody was raised using the N terminal of CRTAP corresponding to a region with amino acids RLFGGLLRRAHCLKRCKQGLPAFRQSQPSREVLADFQRREPYKFLQFAYF</p>

<p>Rabbit polyclonal UBXN4 antibody</p>

<p>Rabbit polyclonal PPP1R11 antibody</p>

<p>Mouse monoclonal PSMC3 antibody</p>

<p>The HP antibody is a cytotoxic monoclonal antibody that acts as a growth factor inhibitor. It is designed to target specific receptors and block their activity, preventing the growth and proliferation of cells. The HP antibody has been shown to be effective in inhibiting the activity of tyrosine kinase inhibitors such as imatinib. It also has neutralizing properties against extracellular histones, which can contribute to inflammation and tissue damage. This antibody is widely used in the field of Life Sciences for research purposes, particularly in studies involving phosphatases and other signaling pathways. With its potent inhibitory effects and specificity, the HP antibody offers great potential for therapeutic applications in various disease conditions.</p>

<p>ACAA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD</p>

<p>Rabbit polyclonal RNF168 antibody</p>

<p>The Chk2 antibody is a highly effective monoclonal antibody used in Life Sciences research. It specifically targets the Mertk protein, an important regulator of cellular processes such as interferon signaling and β-catenin pathway activation. This antibody has been extensively tested and validated for its high specificity and sensitivity in various applications, including Western blotting, immunofluorescence, and immunohistochemistry.</p>

<p>Rabbit polyclonal JNK1/2/3 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using a patch-clamp technique on human erythrocytes. The metabolic transformations of this drug include hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.</p>

<p>Mouse thymocyte antibody was raised in rabbit using RBC-free Mouse thymocytes as the immunogen.</p>

<p>E.coli-derived,-17.2 kDa-Recombinant-Murine IL-2.</p>

<p>Rabbit polyclonal TYMS antibody</p>

<p>EVI2A antibody was raised in rabbit using the C terminal of EVI2A as the immunogen</p>

<p>Purified recombinant PLA1A protein (His tag)</p>

<p>POLE4 antibody was raised in rabbit using the N terminal of POLE4 as the immunogen</p>

<p>MUC1 antibody was raised in mouse using purified native MUC1 as the immunogen.</p>

<p>The MIOX antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets alpha-fetoprotein, an important antigen involved in various biological processes. This antibody is highly specific and has been extensively validated for its accuracy and reliability.</p>

<p>Mouse monoclonal SERPINE2 antibody</p>

<p>Mouse monoclonal PDSS2 antibody</p>

<p>EXOSC7 antibody was raised using the N terminal of EXOSC7 corresponding to a region with amino acids EVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDC</p>

<p>ASXL1 antibody was raised in mouse using recombinant Human Additional Sex Combs Like 1 (Drosophila) (Asxl1)</p>

<p>Purified recombinant POLR1C protein (His tag)</p>

<p>LRRC8C antibody was raised in Rabbit using Human LRRC8C as the immunogen</p>

<p>Matrilin 3 antibody was raised using the N terminal of MATN3 corresponding to a region with amino acids ARGAGVCKSRPLDLVFIIDSSRSVRPLEFTKVKTFVSRIIDTLDIGPADT</p>

<p>GPKOW antibody was raised in Rabbit using Human GPKOW as the immunogen</p>

<p>MRPL38 antibody was raised in Rabbit using Human MRPL38 as the immunogen</p>

<p>ALDH3B1 antibody was raised using the N terminal of ALDH3B1 corresponding to a region with amino acids DPLGDTLRRLREAFHAGRTRPAEFRAAQLQGLGRFLQENKQLLHDALAQD</p>

<p>1-533 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMDR KVAREFRHKV DFLIENDAEK DYLYDVLRMY HQTMDVAVLV GDLKLVINEP SRLPLFDAIR PLIPLKHQVE YDQLTPRRSR KLKEVRLDRL HPEGLGLSVR GGLEFGCGLF ISHLIKGGQA DSVGLQVGDE IVRINGYSIS SCTHEEVINL IRTKKTVSIK VRHIGLIPVK SSPDEPLTWQ YVDQFVSESG GVRGSLGSPG NRENKEKKVF ISLVGSRGLG CSISSGPIQK PGIFISHVKP GSLSAEVGLE IGDQIVEVNG VDFSNLDHKE GRELFMTDRE RLAEARQREL QRQELLMQKR LAMESNKILQ EQQEMERQRR KEIAQKAAEE NERYRKEMEQ IVEEEEKFKK QWEEDWGSKE QLLLPKTITA EVHPVPLRKP KYDQGVEPEL EPADDLDGGT EEQGEQDFRK YEEGFDPYSM FTPEQIMGKD VRLLRIKKEG SLDLALEGGV DSPIGKVVVS AVYERGAAER HGGIVKGDEI MAINGKIVTD YTLAEADAAL QKAWNQGGDW IDLVVAVCPP KEYDDELTFF</p>

<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>

<p>PSA antibody was raised against Human Prostate Specific Antigen (PSA).</p>

<p>Mouse monoclonal NANS antibody</p>

<p>Rabbit polyclonal CREB3L1 antibody</p>

<p>Recombinant Human IL9 protein (His tag)</p>

<p>The TIMP2 antibody is a monoclonal antibody that specifically binds to tissue inhibitor of metalloproteinase 2 (TIMP2). It plays a crucial role in regulating the activity of matrix metalloproteinases (MMPs), which are enzymes involved in the breakdown of extracellular matrix proteins. The TIMP2 antibody inhibits the binding of MMPs to their substrates, thereby preventing tissue degradation and promoting tissue repair.</p>

<p>Rabbit polyclonal RAD1 antibody</p>

<p>Mouse monoclonal SNTA1 antibody</p>

<p>Lamin Type A and C antibody was raised in mouse using Nuclear pore complex-lamina fraction of bovine liver as the immunogen.</p>

<p>The RAB6B antibody is a highly specific monoclonal antibody that is widely used in Life Sciences research. It specifically targets RAB6B, a small GTPase protein involved in intracellular vesicle trafficking. The antibody can be used for various applications such as immunofluorescence, Western blotting, and immunoprecipitation.</p>

<p>The Histone H3 antibody is a highly specialized product used in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and is specifically designed to target and bind to the histone H3 antigen. This antibody is widely used in various research applications, including immunohistochemistry, western blotting, and chromatin immunoprecipitation.</p>

<p>Banoxantrone is a drug that inhibits the growth of some cancer cells. It binds to the peptide receptors on the cell surface, which blocks the ligand-receptor interaction and prevents the activation of protein kinase A. Banoxantrone is also an activator of tyrosine kinase and has been used as a research tool in pharmacology, cell biology, and biochemistry. This drug has been used as an antibody labeling reagent for peptides. Banoxantrone is soluble in water and has a molecular weight of 456.6 g/mol.</p>

<p>Apilimod is a small molecule that inhibits the activity of the signal transduction pathways involved in the activation of lymphocytes and macrophages. It has been shown to inhibit viral replication and neuronal death, as well as to induce significant cytotoxicity. Apilimod also suppresses inflammatory bowel disease by inhibiting TLR-mediated signaling pathways. Apilimod is an inhibitor of toll-like receptor (TLR) signaling for IBDs, including ulcerative colitis and Crohn's disease.</p>

<p>Mouse monoclonal TLE2 antibody</p>

<p>IZUMO1 antibody was raised using the C terminal of IZUMO1 corresponding to a region with amino acids SLALITGLTFAIFRRRKVIDFIKSSLFGLGSGAAEQTQVPKEKATDSRQQ</p>

<p>MB antibody is a polyclonal antibody that specifically targets the isoenzyme of creatine kinase known as MB. This antibody is widely used in the field of Life Sciences to study various aspects of cardiovascular health and disease. The MB antibody has been shown to be effective in neutralizing the activity of collagen, a protein involved in tissue repair and remodeling. Additionally, this antibody can also be used as a diagnostic tool for detecting the presence of autoantibodies associated with certain cardiovascular conditions. The MB antibody is available in both monoclonal and polyclonal forms, providing researchers with options to suit their specific experimental needs.</p>

<p>Purified Recombinant TNFRSF18 protein (His tagged)</p>

<p>SLC4A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGR</p>

<p>IBT6A is an analog of ibuprofen, a nonsteroidal anti-inflammatory drug. It has been shown to be resistant to the inactivation that normally occurs when the prostaglandin H synthase (cyclooxygenase) enzyme converts arachidonic acid into prostaglandin H2. IBT6A is also reactive with tyrosine kinases and may have therapeutic potential as a diagnostic tool for cancer.</p>

<p>FSIP1 antibody was raised using the middle region of FSIP1 corresponding to a region with amino acids DEKDSGLSSSEGDQSGWVVPVKGYELAVTQHQQLAEIDIKLQELSAASPT</p>

<p>The MARCKS antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the protein MARCKS (Myristoylated Alanine-Rich C Kinase Substrate), which plays a crucial role in cellular processes such as cell adhesion, migration, and signaling. The antibody recognizes specific epitopes on the MARCKS protein, including egf-like domains and sugar moieties.</p>

<p>Diethylstilbestrol p-OH Conjugate for use in immunoassays</p>

<p>The AKT1 antibody is a powerful tool in the field of Life Sciences. It is an acidic polymerase that exhibits endonuclease activity and plays a crucial role in regulating protein synthesis. This Monoclonal Antibody specifically targets the growth factor p38 mitogen-activated protein, as well as β-catenin. The activated form of this monoclonal antibody has been shown to have cytotoxic effects on various cell types, including those expressing nuclear factor kappa-light-chain-enhancer. With its high specificity and potency, the AKT1 antibody is an invaluable asset for researchers studying cellular signaling pathways and protein interactions.</p>

<p>The GATA6 antibody is a highly specific monoclonal antibody that targets the human serum. It has been extensively used in Life Sciences research to study the role of GATA6, an important transcription factor involved in various cellular processes. This antibody binds to GATA6 with high affinity and specificity, allowing for accurate detection and quantification of GATA6 levels in biological samples.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZFYVE27 antibody, catalog no. 70R-1730</p>

<p>Mouse monoclonal PRKCE antibody</p>

<p>Purified Polyclonal HOXA11/D11 antibody</p>

<p>Mouse monoclonal EIF2S1 antibody</p>

<p>The UBC9 antibody is a highly reactive protein that is used in various research applications. It specifically targets CD33, a cell surface marker that is expressed on certain immune cells. The UBC9 antibody can be used to detect and quantify CD33 levels in different samples, such as blood or tissue. This antibody is commonly used in life sciences research, particularly in studies related to calmodulin, adipose biology, 3-kinase signaling pathways, and activated immune cells. Additionally, the UBC9 antibody has been shown to have potential therapeutic applications in diseases caused by pathogens like Brucella abortus and oxidative stress-related conditions due to its ability to neutralize superoxide and modulate interleukin-6 activity. Trustworthy and reliable, the UBC9 antibody is an essential tool for researchers looking to explore various aspects of cellular biology and immunology.</p>

<p>NXF1 antibody was raised using the N terminal of NXF1 corresponding to a region with amino acids RPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWFKITIPYG</p>

<p>CENPE Monoclonal Antibody BSA/Azide Free</p>

<p>Mouse monoclonal KCTD14 antibody</p>

<p>The MMP19 antibody is a powerful tool used in the field of Life Sciences. It specifically targets Matrix Metalloproteinase 19 (MMP19), an enzyme that plays a crucial role in various physiological processes. This antibody is widely used in research and diagnostic applications.</p>

<p>SLC4A5 antibody was raised in rabbit using the N terminal of SLC4A5 as the immunogen</p>

<p>Rabbit polyclonal EIF4A2 antibody (HRP)</p>

<p>Rabbit polyclonal RFC4 antibody</p>

<p>Purified Polyclonal GABRB1 antibody</p>

<p>SMN1 antibody is a monoclonal antibody that is widely used in Life Sciences research. It is specifically designed to target and detect Survival Motor Neuron 1 (SMN1) protein. This antibody has been extensively validated in various assays, including immunohistochemistry, Western blotting, and ELISA. SMN1 antibody can be used to study the expression and localization of SMN1 in different tissues and cell types. It has high specificity and sensitivity, ensuring accurate and reliable results. Additionally, this antibody has been shown to have minimal cross-reactivity with other proteins or molecules commonly found in human serum or biological samples. Its exceptional performance makes it an essential tool for researchers studying SMN1-related diseases or exploring the role of SMN1 in cellular processes.</p>

<p>Mouse monoclonal MMAA antibody</p>

<p>PPM1B antibody was raised using a synthetic peptide corresponding to a region with amino acids EIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLN</p>

<p>Osteonectin protein is a crucial component in the field of Life Sciences. It is commonly used in reaction solutions and can be detected using monoclonal antibodies. This Native Protein &amp; Antigen plays a significant role in various biological processes, including cellular protein synthesis and mineralization. Osteonectin protein has been found to interact with histidine, epidermal growth factor, inhibitors, liver microsomes, and human serum. Additionally, it has been studied for its potential involvement in autoimmune diseases as autoantibodies against osteonectin have been detected. Its multifunctional nature makes it a valuable tool for research and the development of new medicines.</p>

<p>The CREB antibody is a highly specialized diagnostic reagent used in Life Sciences research. It is a monoclonal antibody that specifically targets and detects the activated form of CREB (cAMP response element-binding protein), a transcription factor involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting activated CREB in different cell types, including human hepatocytes, pluripotent stem cells, granulosa cells, and collagen-producing cells.</p>

<p>Rabbit polyclonal TCIRG1 antibody</p>

<p>Purified Polyclonal CDC8 antibody</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>RASGEF1A antibody was raised using the N terminal of RASGEF1A corresponding to a region with amino acids TFLLSSRVFMPPHDLLARVGQICVEQKQQLEAGPEKAKLKSFSAKIVQLL</p>

<p>Mouse monoclonal TTLL12 antibody</p>

<p>Mouse monoclonal TOMM34 antibody</p>

<p>CRMP1 antibody was raised using the N terminal of CRMP1 corresponding to a region with amino acids SYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIV</p>

<p>Tachykinin receptor NK2 antagonist</p>

<p>TTC14 antibody was raised using the N terminal of TTC14 corresponding to a region with amino acids MDRDLLRQSLNCHGSSLLSLLRSEQQDNPHFRSLLGSAAEPARGPPPQHP</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>DERL3 antibody was raised using the C terminal of DERL3 corresponding to a region with amino acids YYFLEDVFPNQPGGKRLLQTPGFLKLLLDAPAEDPNYLPLPEEQPGPHLP</p>

<p>Bcl-G antibody was raised in rabbit using residues 298-312 [TKYLKENFSPWIQQH] of the human BCL-G Long form protein as the immunogen.</p>

<p>TTMB antibody was raised using the N terminal Of Ttmb corresponding to a region with amino acids AGYWPHRAGAPGSRAANASSPQMSELRREGRGGGRAHGPHERLRLLGPVI</p>

<p>Slc22a3 antibody was raised in rabbit using the middle region of Slc22a3 as the immunogen</p>

<p>Park2 antibody was raised in rabbit using the C terminal of Park2 as the immunogen</p>