Bioquímicos e reagentes

<p>JMJD6 antibody was raised in rabbit using the N terminal of JMJD6 as the immunogen</p>

<p>The GFAP antibody is a highly specialized tool used in Life Sciences research for insulin detection. It is a monoclonal antibody that specifically targets glial fibrillary acidic protein (GFAP), which is expressed in astrocytes, a type of brain cell. This antibody has been extensively validated and is widely used in various applications such as immunohistochemistry and Western blotting.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAP3K15 antibody, catalog no. 70R-2087</p>

<p>Mouse monoclonal TTC32 antibody</p>

<p>Rabbit polyclonal CPA5 antibody</p>

<p>The AIM2 antibody is a highly effective tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to AIM2, a protein that plays a crucial role in the activation of inflammasomes. By binding to AIM2, this antibody inhibits its function, preventing the activation of downstream signaling pathways that lead to inflammation and cell death.</p>

<p>METTL5 antibody was raised using the N terminal of METTL5 corresponding to a region with amino acids KKVRLKELESRLQQVDGFEKPKLLLEQYPTRPHIAACMLYTIHNTYDDIE</p>

<p>The EMR1 antibody is a powerful tool used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and is commonly used for research purposes. This antibody specifically targets EMR1, a protein known as EGF-like module-containing mucin-like hormone receptor-like 1.</p>

<p>CNTNAP1 antibody was raised using the N terminal of CNTNAP1 corresponding to a region with amino acids LQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNS</p>

<p>DRG1 antibody was raised using the N terminal of DRG1 corresponding to a region with amino acids LAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFVGFPSVGKSTLLSNL</p>

<p>TLR7 antibody was raised in mouse using recombinant human TLR7 (451-500aa) purified from E. coli as the immunogen.</p>

<p>Rabbit polyclonal DHODH antibody</p>

<p>Rabbit polyclonal IL4 antibody (FITC)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. Extensive research has been conducted on this drug using advanced techniques like the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>The pan Cadherin antibody is a powerful tool used in the field of Life Sciences. It plays a crucial role in various biological processes, including cell-cell adhesion, tissue development, and signal transduction. This antibody specifically targets cadherins, a family of proteins that mediate calcium-dependent cell-cell adhesion.</p>

<p>Rabbit polyclonal ABCB7 antibody</p>

<p>ZNF585B antibody was raised in rabbit using the N terminal of ZNF585B as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, inhibiting bacterial growth. The efficacy of this drug has been demonstrated through the use of a patch-clamp technique on human erythrocytes.</p>

<p>Hsp27 antibody was raised in mouse using recombinant human Hsp27 (1-205aa) purified from E. coli as the immunogen.</p>

<p>Mouse monoclonal ALDOB antibody</p>

<p>Rat monoclonal TIM1 antibody (biotin)</p>

<p>Goat anti Human IgM mu chain secondary antibody (FITC) (mu chain specific)</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>The SMAD7 antibody is a monoclonal antibody that targets the protein β-catenin. It has been shown to have inhibitory effects on the natriuretic and growth factor signaling pathways. This antibody specifically binds to interleukin receptors, blocking their activation and downstream signaling. Additionally, it has been found to neutralize the effects of epidermal growth factor and other growth factors involved in cell proliferation and differentiation. The SMAD7 antibody is commonly used in life sciences research for studying cellular signaling pathways and as a tool for investigating the role of β-catenin in various biological processes. With its high specificity and affinity, this antibody is a valuable tool for researchers in the field of molecular biology.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RARA antibody, catalog no. 70R-1301</p>

<p>Rabbit polyclonal Rhombotin 1 antibody (HRP)</p>

<p>WIF1 antibody was raised in Mouse using a purified recombinant fragment of human WIF1 expressed in E. coli as the immunogen.</p>

<p>PSA antibody was raised in mouse using highly pure human Free PSA as the immunogen.</p>

<p>Rabbit polyclonal WRKY65 antibody</p>

<p>Digoxin antibody was raised in mouse using digoxin-BSA as the immunogen.</p>

<p>The Mitochondria antibody is a monoclonal antibody that has neutralizing properties against interferon. It acts by inhibiting the activity of protein kinases and 3-kinase, which are involved in cellular processes such as acetylation and phosphorylation. The antibody is produced through hybridoma cell technology using cellulose as a substrate. It has been shown to react with taxol, a chemotherapy drug used in the treatment of various types of cancer. The Mitochondria antibody is widely used in the field of Life Sciences for research purposes and has proven to be highly effective in studies involving activated cells.</p>

<p>Sheep polyclonal Nitrazepam antibody</p>

<p>Rabbit polyclonal Chl71 antibody</p>

<p>PACRG antibody was raised using the middle region of PACRG corresponding to a region with amino acids GAIMARCNLDHLGSSDPPTSASQVAEIIVNSGDGIDYSQQKRENIGDLIQ</p>

<p>IDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRG</p>

<p>Antithrombin III protein is a crucial component in the field of Life Sciences. It belongs to the group of Proteins and Antigens and is known for its anticoagulant properties. This protein acts as a natural inhibitor of activated clotting factors, thereby preventing excessive blood clot formation. Antithrombin III protein can be used as a therapeutic agent in various medical conditions, such as deep vein thrombosis, pulmonary embolism, and disseminated intravascular coagulation.</p>

<p>Diluent buffer/blocker for use in Poly-HRP enhanced enzymatic labelling of antibodies and antigens. Not biotin-free.</p>

<p>Alpha 2 macroglobulin antibody was raised in goat using human alpha2-macroglobulin as the immunogen.</p>

<p>ADRM1 antibody was raised in rabbit using the C terminal of ADRM1 as the immunogen</p>

<p>MBD4 antibody was raised in Rabbit using Human MBD4 as the immunogen</p>

<p>TPX2 antibody was raised in mouse using recombinant Human Tpx2, Microtubule-Associated, Homolog (Xenopus Laevis) (Tpx2)</p>

<p>Purified Rabbit polyclonal LAT antibody (Tyr171)</p>

<p>Purified recombinant COMMD7 protein (His tag)</p>

<p>Purified native Human TBG protein</p>

<p>Purified recombinant STBD1 protein (His tag)</p>

<p>Purified recombinant CFB protein (His tag)</p>

<p>20-399 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSMEEG LNFPTYDGKD RVVSLSEKNF KQVLKKYDLL CLYYHEPVSS DKVTQKQFQL KEIVLELVAQ VLEHKAIGFV MVDAKKEAKL AKKLGFDEEG SLYILKGDRT IEFDGEFAAD VLVEFLLDLI EDPVEIISSK LEVQAFERIE DYIKLIGFFK SEDSEYYKAF EEAAEHFQPY IKFFATFDKG VAKKLSLKMN EVDFYEPFMD EPIAIPNKPY TEEELVEFVK EHQRPTLRRL RPEEMFETWE DDLNGIHIVA FAEKSDPDGY EFLEILKQVA RDNTDNPDLS ILWIDPDDFP LLVAYWEKTF KIDLFRPQIG VVNVTDADSV WMEIPDDDDL PTAEELEDWI EDVLSGKINT EDDDEDDDDD DNSDEEDNDD SDDDDDE</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Through various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation, it is metabolized in the body. Rifapentine specifically targets markers expressed by Mycobacterium tuberculosis strains and inhibits their growth. With its proven efficacy and multiple mechanisms of action, this drug offers a promising solution for combating tuberculosis.</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>TMEM16A antibody was raised using the middle region of TMEM16A corresponding to a region with amino acids HGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKY</p>

<p>The HDAC3 antibody is a highly specialized monoclonal antibody that acts as a neutralizing agent against the activity of histone deacetylase 3 (HDAC3). It plays a crucial role in regulating gene expression by modifying chromatin structure. The HDAC3 antibody specifically targets and inhibits the enzymatic activity of HDAC3, preventing it from removing acetyl groups from histone proteins. This inhibition leads to increased histone acetylation, resulting in altered gene expression patterns.</p>

<p>Purified Polyclonal OTF3 antibody</p>

<p>The NT5C1A antibody is a polyclonal antibody used in life sciences research. It is specifically designed to target and bind to the NT5C1A protein, which plays a crucial role in various cellular processes. This antibody can be used in experiments involving anti-HER2 antibody, monoclonal antibodies, growth factors, and reaction solutions. Furthermore, it has been shown to have antiangiogenic properties and can inhibit the activity of vascular endothelial growth factor (VEGF), a key regulator of angiogenesis. Additionally, the NT5C1A antibody has been found to be effective in blocking the activation of cardiomyocytes and autoantibodies involved in certain diseases. With its high specificity and reliability, this antibody is an invaluable tool for researchers studying cellular signaling pathways and developing therapeutic interventions.</p>

<p>Mouse monoclonal KCNAB1 antibody</p>

<p>Purified Polyclonal NF kappaB p105 antibody</p>

<p>Rabbit Polyclonal ELOVL5 antibody</p>

<p>Mouse monoclonal SulT1A1 antibody</p>

<p>The TRIM24 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the growth hormone receptor and has been shown to inhibit the activity of this receptor. The TRIM24 antibody is commonly used in studies investigating the role of growth factors, such as trastuzumab, and their interaction with receptors. Additionally, it has been used to study the function of phosphatases and their involvement in cellular signaling pathways. This antibody can be used in various applications, including Western blotting, immunohistochemistry, and flow cytometry. With its high specificity and sensitivity, the TRIM24 antibody is an invaluable tool for researchers studying cell growth and signaling processes.</p>

<p>Rabbit polyclonal MAP2K7 antibody</p>

<p>SIGLEC6 antibody was raised using the N terminal of SIGLEC6 corresponding to a region with amino acids MQGAQEASASEMLPLLLPLLWAGALAQERRFQLEGPESLTVQEGLCVLVP</p>

<p>OR2AT4 antibody was raised using the N terminal of OR2AT4 corresponding to a region with amino acids MDATACNESVDGSPVFYLLGIPSLPETFFLPVFFIFLLFYLLILMGNALI</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>The PRDX3 antibody is a highly specialized product in the field of Life Sciences. It is widely used in various chromatographic techniques and bioassays. This antibody specifically targets nuclear β-catenin, a protein that plays a crucial role in cell signaling and gene expression. The PRDX3 antibody is commonly employed in immunoassays to detect and quantify the levels of β-catenin in biological samples.</p>

<p>IFIH1 antibody was raised in Rabbit using Human IFIH1 as the immunogen</p>

<p>HAAO antibody was raised in Rabbit using Human HAAO as the immunogen</p>

<p>The DCC antibody is a powerful tool for researchers studying kinase signaling pathways. It specifically targets the kinase kinase of the mitogen-activated protein (MAP) kinase pathway, making it an essential component in understanding cellular responses to growth factors and other stimuli. The DCC antibody is available as both monoclonal and polyclonal antibodies, allowing researchers to choose the best option for their specific experiments.</p>

<p>Rabbit polyclonal TPH2 antibody (Ser58)</p>

<p>Rabbit polyclonal VEGFC antibody (FITC)</p>

<p>LAPTM4B antibody was raised using the middle region of LAPTM4B corresponding to a region with amino acids YPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLIS</p>

<p>Mouse monoclonal RIT2 antibody</p>

<p>The STAG2 antibody is a polypeptide used in Life Sciences research. It is a polyclonal antibody that specifically targets the STAG2 antigen. This antibody is commonly used in studies involving nucleic acids and can be used to detect and analyze various nucleic acid molecules. Its high specificity and sensitivity make it an essential tool for researchers working in the field of molecular biology and genetics. With its wide range of applications, the STAG2 antibody is a valuable asset for any laboratory or research facility.</p>

<p>The SYN1 antibody is a highly specialized product used in the field of Life Sciences. It is a polyclonal antibody that specifically targets the SYN1 antigen. This antibody has been extensively tested and proven to be effective in various applications such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assay (ELISA).</p>

<p>Mouse monoclonal Complement H antibody (Biotin)</p>

<p>Purified Polyclonal USP35 antibody</p>

<p>Apramycin Conjugate for use in immunoassays</p>

<p>Rabbit polyclonal BCLW antibody</p>

<p>Junctophilin 2 antibody was raised using the middle region of JPH2 corresponding to a region with amino acids ANQESNIARTLARELAPDFYQPGPEYQKRRLLQEILENSESLLEPPDRGA</p>

<p>Carbonic Anhydrase IV antibody was raised using the middle region of CA4 corresponding to a region with amino acids DGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF</p>

<p>Mouse monoclonal p53 antibody (Prediluted for IHC)</p>

<p>Collagen Type IV alpha 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICL</p>

<p>Mouse monoclonal FOLH1 antibody</p>

<p>Rabbit polyclonal STRADB antibody</p>

<p>TECK antibody was raised in mouse using highly pure recombinant human TECK as the immunogen.</p>

<p>The BECN1 antibody is a monoclonal antibody that specifically targets the epidermal growth factor-like domain of BECN1. It has been shown to neutralize the activity of TNF-α, a pro-inflammatory cytokine involved in various diseases. This specific antibody can inhibit the binding of TNF-α to its receptor and prevent downstream signaling pathways associated with inflammation. In addition, the BECN1 antibody has been found to block the interaction between growth factors and fibronectin, inhibiting cell migration and proliferation. It also shows potential in modulating chemokine expression and regulating TGF-beta signaling. With its wide range of applications in life sciences, this antibody holds promise for research and therapeutic purposes in collagen-related diseases and other inflammatory conditions.</p>

<p>CXCR4 antibody was raised in goat using YSEEVGSGDYDSNKEPCFRDENVHFNR corresponding to the N-terminal extracellular domain of mouse CXCR4 receptor.   as the immunogen.</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>Human IgG Fc antibody was raised in goat using human IgG, Fc fragment as the immunogen.</p>

<p>Mouse monoclonal TFAP2C antibody</p>

<p>MUC1 antibody was raised using the middle region of MUC1 corresponding to a region with amino acids GCAGHCLSHCLGCLSVPPKELRAAGHLSSPGYLPSYERVPHLPHPWALCA</p>

<p>Mouse monoclonal CTDSP1 antibody</p>

<p>Mouse monoclonal SLC2A5 antibody</p>

<p>Sheep polyclonal Ketoprofen antibody</p>

<p>Mouse monoclonal RPN10 antibody</p>

<p>GPD1 antibody was raised in Rabbit using Human GPD1 as the immunogen</p>

<p>Sheep polyclonal 17b Nortestosterone antibody</p>

<p>4-[(6-Chloro-2-methoxy-9-acridinyl)amino]-2-[(4-methyl-1-piperazinyl)methyl]phenol trihydrochloride is an inhibitor of receptor, ligand, and activator. It is a high purity product that is used in life science, pharmacology, and cell biology research. It is also used as a research tool for studying ion channels and peptides. This compound can be used to study protein interactions with antibodies and other proteins.</p>

<p>Purified Polyclonal GYS1 antibody</p>

<p>Rabbit Polyclonal TMEM200A antibody</p>

<p>Purified Rabbit polyclonal OR13G1 antibody</p>

<p>INSIG1 antibody was raised using the middle region of INSIG1 corresponding to a region with amino acids ITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGR</p>