Bioquímicos e reagentes

<p>CHRNA5 antibody was raised using the middle region of CHRNA5 corresponding to a region with amino acids DGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYS</p>

<p>Galnt3 antibody was raised in rabbit using the N terminal of Galnt3 as the immunogen</p>

<p>C3orf31 antibody was raised in rabbit using the middle region of C3ORF31 as the immunogen</p>

<p>Pannexin 2 antibody was raised using the N terminal of PANX2 corresponding to a region with amino acids GTVLVPILLVTLVFTKNFAEEPIYCYTPHNFTRDQALYARGYCWTELRDA</p>

<p>OVA conjugated Sulfamethoxazole Hapten</p>

<p>The PARP2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and neutralize the activity of the poly (ADP-ribose) polymerase 2 (PARP2) protein. This antibody has been extensively tested and validated for its specificity and efficacy.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SIGIRR antibody, catalog no. 70R-6630</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCT8L2 antibody, catalog no. 70R-5062</p>

<p>HNRPL antibody was raised using the N terminal of HNRPL corresponding to a region with amino acids DTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHD</p>

<p>C10ORF96 antibody was raised using the middle region of C10Orf96 corresponding to a region with amino acids QANMLKSEMKSMEHDSSQLNELQKQKSELIQELFTLQRKLKVFEDEENES</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARL5A antibody, catalog no. 70R-5715</p>

<p>The Histamine H3 Receptor antibody is a highly specific monoclonal antibody used in Life Sciences research. It targets the histamine H3 receptor, which is involved in various physiological processes, including neurotransmission and immune responses. This antibody is designed to specifically recognize and bind to the histamine H3 receptor protein found in humans.</p>

<p>Goat anti-monkey IgG (biotin) was raised in goat using monkey IgG as the immunogen.</p>

<p>The L31 protein is a versatile component used in various applications such as plasmids, immunogenic compositions, and recombinant proteins. It has gained attention in the field of androgen research and is known for its ability to stimulate adipose tissue growth. L31 protein is commonly used in the production of monoclonal antibodies and chimeric proteins, making it an essential tool in the development of diagnostic tests and therapeutic interventions. Its neutralizing properties make it an ideal candidate for targeting specific antigens, while its affinity for lipoprotein lipase has shown potential in regulating lipid metabolism. With its diverse range of applications, the L31 protein continues to be a valuable asset in the field of Proteins and Antigens research.</p>

<p>CYP4F12 antibody was raised in Rabbit using Human CYP4F12 as the immunogen</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for its growth. This drug exhibits bactericidal activity, effectively eliminating the bacteria causing the infection. Its mechanism of action involves binding to DNA-dependent RNA polymerase, which hinders transcription and replication processes necessary for bacterial survival. The efficacy of this drug has been demonstrated through rigorous testing using advanced techniques such as patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations in the body, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, 6-Fluoro-3-indoxyl-beta-D-galactopyranos</p>

<p>Purified Polyclonal MYO6 antibody</p>

<p>DBX2 antibody was raised in rabbit using the middle region of DBX2 as the immunogen</p>

<p>Akt, also known as Protein Kinase B (PKB), is a key enzyme involved in regulating cell growth, survival, metabolism, and proliferation within the PI3K/Akt/mTOR pathway, which responds to signals like growth factors. Upon activation through specific phosphorylation events, Akt drives essential cellular functions, including promoting cell survival, stimulating protein synthesis via mTOR, regulating glucose uptake, and facilitating blood vessel formation and cell movement. Due to its frequent hyperactivation in cancers, Akt is a significant target in cancer therapies, and its role in glucose metabolism links it to conditions like insulin resistance and type 2 diabetes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNK4 antibody, catalog no. 70R-5192</p>

<p>1-129 amino acids: MGSSHHHHHH SSGLVPRGSH MSHLQSLLLD TLLGTKHVDS AALIKIQERS LCVASPGFNV TPSDVRTLVN GFAKNPLQAR REGLYFKGKD YRCVRADEYS LYAKNENTGV VVVKTHLYLL VATYTEGMYP SICVEATESL GDYLRKKGS</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HIP2 antibody, catalog no. 70R-1148</p>

<p>GRK7 antibody was raised in rabbit using the C terminal of GRK7 as the immunogen</p>

<p>HPD antibody was raised in Rabbit using Human HPD as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Zfp113 antibody, catalog no. 70R-8906</p>

<p>Rabbit polyclonal MRPL14 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SCRT2 antibody, catalog no. 70R-8980</p>

<p>Rabbit polyclonal RPS25 antibody</p>

<p>Rabbit polyclonal NFAT5 antibody (Ser155)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TPRKB antibody, catalog no. 70R-4344</p>

<p>Goat anti-mouse IgM (HRP) was raised in goat using murine IgM mu chain as the immunogen.</p>

1-122 amino acids: MGSSHHHHHH SSGLVPRGSH MEAVLNELVS VEDLLKFEKK FQSEKAAGSV SKSTQFEYAW CLVRSKYNDD IRKGIVLLEE LLPKGSKEEQ RDYVFYLAVG NYRLKEYEKA LKYVRGLLQT EPQNNQAKEL ERLIDKAMKK DG

<p>Rabbit polyclonal ISL2 antibody</p>

<p>The CD153 antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets CD153, a protein expressed on pluripotent stem cells. This antibody can be used in various research assays and experiments to study the function and behavior of pluripotent stem cells.</p>

<p>Rabbit Polyclonal Caveolin antibody (Tyr14)</p>

<p>The E.coli derived recombinant protein contains the HCV NS5 immunodominant regions, amino acids 2061-2302. The protein is fused with GST at N-terminus.</p>

<p>Rabbit polyclonal GABARAPL1 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of P2RX2 antibody, catalog no. 70R-5166</p>

<p>EXOSC10 antibody was raised using the C terminal of EXOSC10 corresponding to a region with amino acids FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRG</p>

<p>The LCK antibody is a powerful cytotoxic agent that specifically targets the LCK receptor. It has been extensively studied and proven to have high affinity binding to the LCK receptor, making it an effective medicament for various applications. The LCK antibody can be used in research laboratories as well as in clinical settings.</p>

<p>Affinity purified Rabbit polyclonal EML1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NLK antibody, catalog no. 70R-9450</p>

<p>Kallikrein 2 Monoclonal Antibody BSA/Azide Free</p>

<p>HIV1 antibody (HTLV3) was raised in goat using human isolate as the immunogen.</p>

<p>The MEK2 antibody is a polyclonal antibody used in life sciences research. It specifically targets and binds to MEK2, a protein involved in the TGF-beta signaling pathway. This antibody can be used to study various cellular processes, including collagen synthesis, growth factor signaling, and cell proliferation. The MEK2 antibody has been extensively validated for use in multiple applications such as Western blotting, immunohistochemistry, and flow cytometry. Its high specificity and sensitivity make it an ideal tool for researchers studying the role of MEK2 in different biological systems. With its wide range of applications and reliable performance, the MEK2 antibody is an essential component of any laboratory focused on understanding cellular signaling pathways.</p>

<p>The S100 antibody is a highly specialized protein that plays a crucial role in various biological processes. It acts as a phosphatase and interacts with other proteins such as erythropoietin, interleukin-6, actin, collagen, fibrinogen, and β-catenin. This antibody is widely used in the field of Life Sciences for research purposes.</p>

<p>Goat anti-bovine IgG (FITC) was raised in goat using bovine IgG F(ab')2 fragment as the immunogen.</p>

<p>The NT3 antibody is a specific antibody that targets adeno-associated inhibitors. It is commonly used in pluripotent stem cell research to study the effects of dopamine and other neurotransmitters. This antibody can also be used in various assays, such as enzyme-linked immunosorbent assays (ELISAs) or Western blotting, to detect the presence of NT3 in samples. Additionally, it has been shown to have potential therapeutic applications in treating diseases related to autoantibodies or collagen disorders. The NT3 antibody has high specificity and sensitivity, making it a valuable tool for researchers and clinicians alike.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPP1R3B antibody, catalog no. 70R-10399</p>

<p>STAT3 antibody was raised in Mouse using a purified recombinant fragment of STAT3 expressed in E. coli as the immunogen.</p>

Region of GDNF protein corresponding to amino acids MSPDKQAAAL PRRERNRQAA AASPENSRGK GRRGQRGKNR GCVLTAIHLN VTDLGLGYET KEELIFRYCS GSCEAAETMY DKILKNLSRS RRLTSDKVGQ ACCRPVAFDD DLSFLDDSLV YHILRKHSAK RCGCI.

<p>The Human IgG antibody is a powerful inhibitory factor that targets various proteins and factors in the body. It has been shown to inhibit the activity of GM-CSF (colony-stimulating factor) and other cytokines involved in immune response regulation. This Monoclonal Antibody specifically binds to alpha-fetoprotein, autoantibodies, and antiphospholipid antibodies, neutralizing their effects. Additionally, it has been found to have a significant impact on interferon signaling pathways.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BTN1A1 antibody, catalog no. 70R-7235</p>

<p>Purified Polyclonal PDGFA antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OR2C3 antibody, catalog no. 70R-9859</p>

<p>The CDCA2 antibody is a highly effective protein kinase inhibitor that belongs to the family of kinase inhibitors. It is used in the field of Life Sciences as a valuable tool for studying various cellular processes. The CDCA2 antibody specifically targets TGF-beta, which is a key signaling molecule involved in cell growth and differentiation. This antibody can be used in both polyclonal and monoclonal forms, allowing for flexibility in experimental design. In addition to its use as a research tool, the CDCA2 antibody has also shown potential therapeutic applications, particularly in the field of regenerative medicine. It has been found to enhance the differentiation potential of mesenchymal stem cells and promote tissue regeneration. With its ability to inhibit specific kinases and modulate important cellular pathways, the CDCA2 antibody is an indispensable tool for researchers in various fields of study.</p>

<p>Rabbit polyclonal JAK1 antibody (Tyr1022)</p>

<p>HSV2 enriched cell lysate</p>

<p>Rabbit polyclonal TPM1 antibody</p>

<p>The Netrin 1 antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to Netrin 1, a protein involved in various cellular processes. It has been extensively tested and validated for its high specificity and affinity towards Netrin 1.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Fkrp antibody, catalog no. 70R-8609</p>

<p>1-369 amino acids: MDPRKVNELR AFVKMCKQDP SVLHTEEMRF LREWVESMGG KVPPATQKAK SEENTKEEKP DSKKVEEDLK ADEPSSEESD LEIDKEGVIE PDTDAPQEMG DENAEITEEM MDQANDKKVA AIEALNDGEL QKAIDLFTDA IKLNPRLAIL YAKRASVFVK LQKPNAAIRD CDRAIEINPD SAQPYKWRGK AHRLLGHWEE AAHDLALACK LDYDEDASAM LKEVQPRAQK IAEHRRKYER KREEREIKER IERVKKAREE HERAQREEEA RRQSGAQYGS FPGGFPGGMP GNFPGGMPGM GGGMPGMAGM PGLNEILSDP EVLAAMQDPE VMVAFQDVAQ NPANMSKYQS NPKVMNLISK LSAKFGGQA</p>

<p>Rabbit polyclonal BLM antibody (Thr99)</p>

<p>MED31 antibody was raised using the N terminal of MED31 corresponding to a region with amino acids MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVN</p>

<p>LOC728227 antibody was raised using the C terminal of LOC728227 corresponding to a region with amino acids  GAGGAKSRGGQKAASARVKKPRRRGGKKPGQAKSHGGREQKAAAAGCKKP</p>

<p>RALY antibody was raised using the middle region of RALY corresponding to a region with amino acids KIKLKSSELQAIKTELTQIKSNIDALLSRLEQIAAEQKANPDGKKKGDGG</p>

Rabbit anti-dog IgG (H+L) (Alk Phos) was raised in rabbit using canine IgG whole molecule as the immunogen.

<p>Purified Cat IgG (Fab) FITC conjugate</p>

<p>The GCP3 antibody is a highly specialized diagnostic reagent used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and exhibits strong antigen-antibody reaction capabilities. This antibody is particularly effective in quantitating growth factors and neutralizing reactive substances in adipose tissues. With its unique properties, the GCP3 antibody can be used as a powerful tool for researchers and clinicians alike.</p>

<p>Rabbit polyclonal ATF7 antibody</p>

<p>Purified Polyclonal CHAC1 antibody</p>

<p>The Apelin antibody is a multidrug that belongs to the class of Polyclonal Antibodies. It targets apelin, which is a growth factor involved in various physiological processes. The antibody can be used for research purposes in the field of Life Sciences, particularly in studies related to lipase activity, adipose tissue function, and cell signaling pathways. It has been shown to have potential therapeutic applications in the treatment of conditions such as obesity and cardiovascular diseases. The Apelin antibody is available in both monoclonal and polyclonal forms, allowing researchers to choose the most suitable option based on their specific experimental needs. With its ability to detect and bind to apelin with high specificity and sensitivity, this antibody is an invaluable tool for studying the role of apelin in various biological processes.</p>

<p>SLC36A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLLGRDYNSELNSLDNGPQSPSESSSSITSENVHPAGEAGLSMMQTLIH</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. Known for its bactericidal activity, this drug effectively treats tuberculosis infections. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. The efficacy of this drug has been demonstrated through various scientific techniques such as patch-clamp technique on human erythrocytes. Metabolized through different metabolic transformations, including hydrolysis and oxidation, this drug specifically targets Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DHODH antibody, catalog no. 70R-6503</p>

<p>Streptavidin (PE) is a monoclonal antibody that is commonly used in Life Sciences research. It is often conjugated with other proteins and antigens for various applications. Streptavidin (PE) has a high affinity for biotin, making it an excellent tool for detecting and quantifying biotinylated molecules. This antibody can be used in a wide range of experiments, including immunofluorescence staining, flow cytometry, and enzyme-linked immunosorbent assays (ELISA). Additionally, Streptavidin (PE) has been shown to have neutralizing effects on certain growth factors and chemokines, making it a valuable tool in cell culture studies. Its reactive properties also make it useful in electrode-based assays and mitochondrial superoxide detection. With its versatility and reliability, Streptavidin (PE) is an essential component in many research laboratories worldwide.</p>

<p>ASCL4 antibody was raised in rabbit using the N terminal of ASCL4 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CATSPER2 antibody, catalog no. 70R-5069</p>

<p>5 nm Colloidal Gold particle suspension</p>

<p>Affinity purified Rabbit polyclonal UTP6 antibody</p>

<p>Purified Polyclonal PRKAR1B antibody</p>

<p>Rabbit polyclonal FAK antibody (Tyr925)</p>

<p>Thyroid Peroxidase antibody is a monoclonal antibody used in Life Sciences research. It targets the thyroid peroxidase enzyme, which plays a crucial role in thyroid hormone synthesis. This antibody can be used to study the regulation and function of thyroid peroxidase, as well as its involvement in autoimmune thyroid diseases. Additionally, Thyroid Peroxidase antibody has been shown to have growth factor-like activity and can activate various signaling pathways. It has also been found to be involved in the glycosylation of proteins, including fibrinogen. Furthermore, this antibody has potential diagnostic applications as it can detect autoantibodies against thyroid peroxidase, which are often present in patients with autoimmune thyroid disorders. Overall, Thyroid Peroxidase antibody is a valuable tool for researchers studying thyroid biology and related diseases.</p>

<p>Purified recombinant Human BCAS2 protein</p>

<p>The HNF4 alpha antibody is a highly effective reagent used in the field of Life Sciences. It has the ability to inhibit the function of hematopoietic and pluripotent stem cells, making it a valuable tool for research and therapeutic applications. This antibody can be used in immunohistochemical studies to detect the presence of HNF4 alpha protein in various tissues and cell types. It is a polyclonal antibody, meaning it recognizes multiple epitopes on the target protein, resulting in high specificity and sensitivity. With its ability to accurately detect HNF4 alpha, researchers can gain valuable insights into the role of this protein in cellular processes and disease mechanisms. Whether you are studying cytokines or pluripotent stem cells, this HNF4 alpha antibody is an essential tool for your research needs.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NLGN4X antibody, catalog no. 70R-6162</p>

<p>The GAPDH Blocking Peptide is a versatile biomolecule that can be used in various life science applications. This peptide is designed to block the binding of proteins, such as chemokines and growth factors, to GAPDH (Glyceraldehyde-3-phosphate dehydrogenase). By preventing this interaction, the peptide inhibits downstream signaling pathways and cellular processes.</p>

<p>RAB8B antibody was raised in rabbit using the C terminal of RAB8B as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycins class. It is specifically designed to combat tuberculosis infections by targeting active compounds and exerting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication of bacteria. Its effectiveness has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes various metabolic transformations such as hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, this drug specifically binds to markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SRP19 antibody, catalog no. 70R-4850</p>

The SARS-CoV-2 Spike Antibody is a highly effective inhibitor that belongs to the family of neutralizing antibodies. It is widely used in Life Sciences for various applications, including immunogenic compositions and assays. This antibody has been proven to effectively target the spike protein of the SARS-CoV-2 virus, which plays a crucial role in viral entry into host cells. By binding to the spike protein, this antibody prevents viral attachment and fusion, thereby inhibiting viral replication and spread.

<p>GLS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DAAM1 antibody, catalog no. 70R-2236</p>

<p>The HDAC5 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. This antibody specifically targets and binds to HDAC5, which stands for Histone Deacetylase 5. HDAC5 is an enzyme involved in the regulation of gene expression by modifying histones, which are proteins that help package DNA in cells. By binding to HDAC5, this antibody can modulate its activity and potentially impact various cellular processes.</p>

<p>Coronavirus Nucleoprotein (NP) monoclonal antibody</p>

<p>Purified Polyclonal Kir3.3 antibody</p>

<p>1-177 amino acids: MAVANSSPVN PVVFFDVSIG GQEVGRMKIE LFADVVPKTA ENFRQFCTGE FRKDGVPIGY KGSTFHRVIK DFMIQGGDFV NGDGTGVASI YRGPFADENF KLRHSAPGLL SMANSGPSTN GCQFFITCSK CDWLDGKHVV FGKIIDGLLV MRKIENVPTG PNNKPKLPVV ISQCGEM</p>

<p>The SOX17 antibody is a monoclonal antibody that specifically targets glucagon, a hormone involved in regulating blood sugar levels. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It can be used to detect and measure glucagon levels in human serum, making it a valuable tool for research and diagnostic purposes. Additionally, the SOX17 antibody has been found to have cytotoxic effects on certain cancer cells, making it a potential candidate for targeted therapy. Its high specificity and affinity for glucagon make it an ideal choice for experiments involving the detection and manipulation of this hormone. Whether you are studying the role of glucagon in diabetes or investigating its interaction with other molecules such as insulin or collagen, the SOX17 antibody is an indispensable tool that will provide reliable and accurate results.</p>

<p>Mecamylamine HCL (USP grade powder) chemical reference substance</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRDM13 antibody, catalog no. 70R-8363</p>

<p>COX5B antibody was raised in Rabbit using Human COX5B as the immunogen</p>

<p>IP10 antibody was raised in rabbit using highly pure recombinant rat IP-10 as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF233 antibody, catalog no. 70R-8164</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KRTAP11-1 antibody, catalog no. 70R-3239</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GSTK1 antibody, catalog no. 70R-4024</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ERLIN1 antibody, catalog no. 70R-7393</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RNF121 antibody, catalog no. 70R-6550</p>

<p>The TFEB antibody is a highly specialized product in the field of Life Sciences. It is designed to specifically bind to the TFEB receptor, which plays a crucial role in various cellular processes such as glucagon signaling and collagen synthesis. This antibody is widely used in research laboratories for studying the function and regulation of TFEB.</p>

MRPS36 antibody was raised in Rabbit using Human MRPS36 as the immunogen

<p>CD18 antibody was raised in mouse using leucocytes from LGL-type leukemia as the immunogen.</p>

<p>Purified Polyclonal cCBL antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ERC1 antibody, catalog no. 70R-9796</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC1A2 antibody, catalog no. 70R-6543</p>

A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINE2 antibody, catalog no. 70R-5431

<p>Affinity purified Rabbit polyclonal SSX2 antibody</p>

<p>The NFkB p65 antibody is a polyclonal antibody that is used for various applications in the field of Life Sciences. It is specifically designed to target and neutralize the NFkB p65 protein, which plays a crucial role in cellular signaling pathways. This antibody can be used for techniques such as hybridization, immunoprecipitation, and immunofluorescence.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FZD6 antibody, catalog no. 70R-7308</p>

Polacrilin Potassium (USP grade powder) chemical reference substance

<p>Rabbit polyclonal MKL1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MMP24 antibody, catalog no. 70R-6357</p>

<p>The BAFF antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes the activity of BAFF (B-cell activating factor), a protein involved in the activation and survival of B-cells. This antibody has been extensively tested and proven to be effective in blocking the activity of BAFF, thereby preventing the proliferation and differentiation of B-cells.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of POLK antibody, catalog no. 70R-5522</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAP2K3 antibody, catalog no. 70R-2684</p>

<p>ALOX15B antibody was raised using the C terminal of ALOX15B corresponding to a region with amino acids ATCEGFIATLPPVNATCDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPR</p>

<p>Purified Polyclonal CK1 alpha antibody</p>

<p>C2ORF29 antibody was raised using the middle region of C2Orf29 corresponding to a region with amino acids SVDISGLQLALAERQSELPTQSKASFPSILSDPDPDSSNSGFDSSVASQI</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.</p>

<p>Goat anti-bovine IgG (H + L) was raised in goat using ovine IgG (H &amp; L) as the immunogen.</p>

<p>Rabbit polyclonal GRP78 antibody (HRP)</p>

<p>Affinity purified Rabbit polyclonal MANBA antibody</p>

<p>FN3KRP antibody was raised in Rabbit using Human FN3KRP as the immunogen</p>

<p>Rabbit polyclonal RPL27 antibody (HRP)</p>

Rabbit polyclonal NOL3 antibody

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MGC50273 antibody, catalog no. 70R-4290</p>

<p>Isoxsuprine Conjugate for use in immunoassays</p>

<p>GATA1 antibody was raised in Rabbit using Human GATA1 as the immunogen</p>

<p>Rabbit polyclonal ZNF187 antibody</p>

<p>The IL1b antibody is a monoclonal antibody that specifically targets IL-1β, a pro-inflammatory cytokine involved in various immune and inflammatory responses. This antibody binds to IL-1β and prevents its interaction with its receptors, thereby inhibiting the downstream signaling pathways that lead to inflammation.</p>

<p>Rabbit polyclonal ADARB1 antibody</p>

<p>AP3M2 antibody was raised in Rabbit using Human AP3M2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SOX17 antibody, catalog no. 70R-8369</p>

<p>Rabbit anti-mouse IgG3 (HRP) was raised in rabbit using murine IgG3 heavy chain as the immunogen.</p>

<p>ERAL1 antibody was raised in Rabbit using Human ERAL1 as the immunogen</p>

<p>RNF121 antibody was raised using the N terminal of RNF121 corresponding to a region with amino acids WWRFLVIWILFSAVTAFVTFRATRKPLVQTTPRLVYKWFLLIYKISYATG</p>

<p>CARS antibody was raised using the C terminal of CARS corresponding to a region with amino acids KRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHD</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EIF4B antibody, catalog no. 70R-1418</p>

<p>The alpha Synuclein antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. This antibody specifically targets and binds to alpha Synuclein, a protein that plays a crucial role in the pathogenesis of neurodegenerative diseases such as Parkinson's disease. By binding to alpha Synuclein, this antibody inhibits its activity and prevents the formation of toxic aggregates, which are believed to be responsible for the progression of these diseases. Additionally, this antibody has been shown to have anti-inflammatory properties by inhibiting the production of interleukin-6, a pro-inflammatory cytokine. With its high specificity and potent inhibitory effects, the alpha Synuclein antibody is an invaluable tool for researchers studying neurodegenerative disorders and developing potential therapeutic interventions.</p>

<p>ATF6B antibody was raised in Rabbit using Human ATF6B as the immunogen</p>

<p>The CXCL4 antibody is a highly effective monoclonal antibody that targets multidrug-resistant bacteria. It contains histidine residues that enhance its binding affinity and specificity. This antibody has been extensively studied for its potential in treating various diseases, including cancer and neurodegenerative disorders.</p>

<p>OR2M5 antibody was raised in rabbit using the C terminal of OR2M5 as the immunogen</p>

<p>Complement C4 antibody was raised in goat using highly purified human complement protein as the immunogen.</p>

The NRCAM antibody is a growth factor that plays a crucial role in various biological processes. It is commonly used in Life Sciences research for its ability to detect autoantibodies and virus surface antigens. This antibody can be used in a variety of applications, including immunohistochemistry, Western blotting, and ELISA. The NRCAM antibody is available as both polyclonal and monoclonal antibodies, allowing researchers to choose the best option for their specific experiment. With its high specificity and sensitivity, this antibody ensures accurate and reliable results. Additionally, it can be conjugated with colloidal gold or other markers for enhanced detection. Whether you're studying protein expression or investigating immune responses, the NRCAM antibody is an invaluable tool in your research arsenal.

<p>Purified recombinant E.coli NFNB protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC39A7 antibody, catalog no. 70R-6256</p>

<p>Rabbit polyclonal rpS6 antibody (Ser235+Ser236)</p>

<p>DDAAIQQTLA KMGIKSSDIQ PAPVAGMKTV LTNSGVLYIT DDGKHIIQGP MYDVSGTAPV NVTNKMLLKQ LNALEKEMIV YKAPQEKHVI TVFTDITCGY CHKLHEQMAD YNALGITVRY LAFPRQGLDS DAEKEMKAIW CAKDKNKAFD DVMAGKSVAP ASCDVDIADH YVLGVQLGVS GTPAVVLSNG TLVPGYQPPK EMKEFLDEHQ KMTSGK</p>

<p>The SGK1 antibody is a highly specialized antibody that targets the dopamine-regulated protein kinase SGK1. It is available in both polyclonal and monoclonal forms, making it suitable for a wide range of research applications. This antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>Purified Polyclonal NPAS1 antibody</p>

<p>Rabbit polyclonal CDMPR antibody (HRP)</p>

<p>GM-CSF antibody was raised in rabbit using highly pure recombinant murine GM-CSF as the immunogen.</p>

MVK antibody was raised in Rabbit using Human MVK as the immunogen

<p>Region of MCP1 protein corresponding to amino acids QPDAVNAPLT CCYSFTSKMI PMSRLESYKR ITSSRCPKEA VVFVTKLKRE VCADPKKEWV QTYIKNLDRN QMRSEPTTLF KTASALRSSA PLNVKLTRKS EANASTTFST TTSSTSVGVT SVTVN.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPTLC1 antibody, catalog no. 70R-6555</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Utx antibody, catalog no. 70R-7989</p>

<p>Rabbit polyclonal CREBZF antibody</p>

<p>ALDH1A1 antibody was raised in Rabbit using Human ALDH1A1 as the immunogen</p>

<p>The Antithrombin III antibody is a monoclonal antibody that targets and binds to Antithrombin III, a protein involved in blood clotting regulation. This antibody has been shown to inhibit the activity of Antithrombin III by blocking its binding to various proteins, including chemokines and growth factors. By doing so, it prevents the activation of response element-binding proteins and reduces the production of inflammatory mediators.</p>

<p>SLC22A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHR</p>

<p>Rabbit polyclonal PPP1R1B antibody (Ser137)</p>

<p>33-173 amino acids: MGSSHHHHHH SSGLVPRGSH MSEPTTVAFD VRPGGVVHSF SHNVGPGDKY TCMFTYASQG GTNEQWQMSL GTSEDHQHFT CTIWRPQGKS YLYFTQFKAE VRGAEIEYAM AYSKAAFERE SDVPLKTEEF EVTKTAVAHR PGAFKAELSK LVIVAKASRT EL</p>

<p>The GAPDH antibody is a highly specialized and pegylated antibody that targets the glycoprotein known as glyceraldehyde-3-phosphate dehydrogenase (GAPDH). This antibody plays a crucial role in various biological processes, including epidermal growth factor (EGF) signaling, microvessel density regulation, and growth factor activity.</p>

<p>Affinity purified Rabbit polyclonal DNA polymerase gamma antibody</p>

<p>FMO3 antibody was raised in Rabbit using Human FMO3 as the immunogen</p>

<p>Rabbit polyclonal TRIM16 antibody</p>

<p>The Calretinin antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It is designed to target and detect the presence of calretinin, a calcium-binding protein found in various tissues and cells. This antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>Purified Polyclonal Carboxypeptidase E antibody</p>

<p>The HIPK4 antibody is a polyclonal antibody that specifically targets the protein complex known as homeodomain-interacting protein kinase 4 (HIPK4). This antibody is widely used in various life sciences research applications, including the study of glycosylation, growth factors, and biomolecules. It has been shown to be effective in detecting and quantifying HIPK4 levels in different cell types and tissues.</p>

<p>Rabbit Polyclonal HDAC8 antibody (Ser39)</p>